Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.08
PubTator Score 0.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma -1.100 1.8e-02
invasive ductal carcinoma 1.235 2.7e-03
non-small cell lung cancer -1.593 5.9e-19
osteosarcoma -1.301 2.2e-03
subependymal giant cell astrocytoma 2.005 2.3e-02
tuberculosis and treatment for 6 months -1.600 7.4e-03

Gene RIF (1)

AA Sequence

MESTSQDRRATHVITIKPNETVLTAFPYRPHSSLLDFLKGEPRVLGATQILLALIIVGFGTIFALNYIGF      1 - 70
SQRLPLVVLTGYPFWGALIFILTGYLTVTDKKSKLLGQGVTGMNVISSLVAITGITFTILSYRHQDKYCQ     71 - 140
MPSFEEICVFSRTLFIVLFFLPSDVTQNSEQPAPEENDQLQFVLQEEFSSDDSTTNAQSVIFGGYAFFKL    141 - 210
TLSRSPLVSQPGNKGREFVPDEQKQSILPSPKFSEEEIEPLPPTLEKKPSENMSIQLDSTFKQMKDEDLQ    211 - 280
SAIVQPSQMQTKLLQDQAASLQVFPSHSALKLEDISPEDLPSQALPVEGLSEQTMPSKSTSSHVKQSSNL    281 - 350
TANDLPPQGILSQDTSSQDMLFHDMTSQDMQSLDMLSQDTPSHAMPPQDIPSQDMLSQALSAHAILPEAS    351 - 420
TSHIVQFPEIQHLLQQPPDLQPENTEPQNQQILQMSYQDIRSEVMEETKEWKSEEELHRRKSSRRHSLNQ    421 - 490
QTKALQYLRRHSLDVQAKGQKSSKRHSLDQQSKGWQSPKQKSLDQQIKDWLSPKRHSVDKQAQLNQTKEQ    491 - 560
LPDQQAEDQQAKGEQYPEGQSKDGQVKDQQTDKEQNSKKQTQDQQTEDQPAQEKKSPKGQFQNVQAEGQQ    561 - 630
AQVEKVPKLLCQDSESQIQQYQFWQFHKGNLQAGQPRTVNLLAKNPLTG                         631 - 679
//

Text Mined References (7)

PMID Year Title