Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.67
PubTator Score 17.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
gastric cancer 1.100 0.001
pancreatic cancer 1.100 0.003
adrenocortical carcinoma 1.714 0.000
intraductal papillary-mucinous neoplasm ... 2.000 0.002
pancreatic carcinoma 1.100 0.003
ovarian cancer 1.900 0.000

Gene RIF (8)

PMID Text
25122779 Altogether, this study implies that hepatitis C virus coopts FAPP2 for virus genome replication via phosphatidylinositol 4-phosphate binding and glycosphingolipid transport to the hepatitis C virus replication complex.
22266015 FAPP2 functions in both membrane trafficking and lipid metabolism in a fashion that integrates its activities in membrane trafficking and in lipid transfer. (Review)
19940249 Data show that FAPP2 is present in tubules forming from the trans-Golgi in epithelial MDCK cells.
19341712 These data demonstrate a previously unknown role for FAPP2 in conferring resistance to apoptosis and indicate that FAPP2 may be a target for cancer therapy.
17687330 by coupling the synthesis of glycosphingolipids with their export to the cell surface, FAPP2 emerges as crucial in determining the lipid identity and composition of the plasma membrane
17116893 Data demonstrate FAPP2 is required for cilium formation in polarized MDCK cells.
16103222 FAPP2 plays a specific role in apical transport in MDCK cells.
15107860 Data show that FAPP1 and 2 are essential components of a phosphatidylinositol 4-phosphate- and ADP-ribosylation factor-regulated machinery that controls generation of constitutive post-Golgi carriers.

AA Sequence

MEGVLYKWTNYLSGWQPRWFLLCGGILSYYDSPEDAWKGCKGSIQMAVCEIQVHSVDNTRMDLIIPGEQY      1 - 70
FYLKARSVAERQRWLVALGSAKACLTDSRTQKEKEFAENTENLKTKMSELRLYCDLLVQQVDKTKEVTTT     71 - 140
GVSNSEEGIDVGTLLKSTCNTFLKTLEECMQIANAAFTSELLYRTPPGSPQLAMLKSSKMKHPIIPIHNS    141 - 210
LERQMELSTCENGSLNMEINGEEEILMKNKNSLYLKSAEIDCSISSEENTDDNITVQGEIRKEDGMENLK    211 - 280
NHDNNLTQSGSDSSCSPECLWEEGKEVIPTFFSTMNTSFSDIELLEDSGIPTEAFLASCYAVVPVLDKLG    281 - 350
PTVFAPVKMDLVGNIKKVNQKYITNKEEFTTLQKIVLHEVEADVAQVRNSATEALLWLKRGLKFLKGFLT    351 - 420
EVKNGEKDIQTALNNAYGKTLRQHHGWVVRGVFALALRAAPSYEDFVAALTVKEGDHQKEAFSIGMQRDL    421 - 490
SLYLPAMEKQLAILDTLYEVHGLESDEVV                                             491 - 519
//

Text Mined References (17)

PMID Year Title
25122779 2014 Modulation of hepatitis C virus genome replication by glycosphingolipids and four-phosphate adaptor protein 2.
22675492 2012 Genome-wide association study of circulating estradiol, testosterone, and sex hormone-binding globulin in postmenopausal women.
22266015 2012 Connecting vesicular transport with lipid synthesis: FAPP2.
20482226 2010 Gene expression profiles for predicting the efficacy of the anticancer drug 5-fluorouracil in breast cancer.
19940249 2009 Golgi protein FAPP2 tubulates membranes.
19341712 2009 FAPP2 gene downregulation increases tumor cell sensitivity to Fas-induced apoptosis.
18459163 2008 Two sphingolipid transfer proteins, CERT and FAPP2: their roles in sphingolipid metabolism.
17687330 2007 Glycosphingolipid synthesis requires FAPP2 transfer of glucosylceramide.
17116893 2006 FAPP2, cilium formation, and compartmentalization of the apical membrane in polarized Madin-Darby canine kidney (MDCK) cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...