Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.67
PubTator Score 17.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 1.4

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma 1.714 7.2e-06
gastric cancer 1.100 1.4e-03
intraductal papillary-mucinous neoplasm ... 2.000 1.9e-03
ovarian cancer -1.700 4.2e-07
pancreatic cancer 1.100 2.9e-03
pancreatic carcinoma 1.100 2.9e-03

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (8)

AA Sequence

MEGVLYKWTNYLSGWQPRWFLLCGGILSYYDSPEDAWKGCKGSIQMAVCEIQVHSVDNTRMDLIIPGEQY      1 - 70
FYLKARSVAERQRWLVALGSAKACLTDSRTQKEKEFAENTENLKTKMSELRLYCDLLVQQVDKTKEVTTT     71 - 140
GVSNSEEGIDVGTLLKSTCNTFLKTLEECMQIANAAFTSELLYRTPPGSPQLAMLKSSKMKHPIIPIHNS    141 - 210
LERQMELSTCENGSLNMEINGEEEILMKNKNSLYLKSAEIDCSISSEENTDDNITVQGEIRKEDGMENLK    211 - 280
NHDNNLTQSGSDSSCSPECLWEEGKEVIPTFFSTMNTSFSDIELLEDSGIPTEAFLASCYAVVPVLDKLG    281 - 350
PTVFAPVKMDLVGNIKKVNQKYITNKEEFTTLQKIVLHEVEADVAQVRNSATEALLWLKRGLKFLKGFLT    351 - 420
EVKNGEKDIQTALNNAYGKTLRQHHGWVVRGVFALALRAAPSYEDFVAALTVKEGDHQKEAFSIGMQRDL    421 - 490
SLYLPAMEKQLAILDTLYEVHGLESDEVV                                             491 - 519
//

Text Mined References (17)

PMID Year Title