Property Summary

NCBI Gene PubMed Count 60
Grant Count 38
R01 Count 29
Funding $1,956,029.43
PubMed Score 79.41
PubTator Score 73.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
astrocytic glioma 2.100 0.002
ependymoma 1.700 0.008
oligodendroglioma 2.600 0.001
psoriasis -1.200 0.000
osteosarcoma -2.172 0.020
group 4 medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.400 0.005
glioblastoma 1.200 0.003
medulloblastoma, large-cell -1.800 0.000
tuberculosis -1.500 0.000
intraductal papillary-mucinous adenoma (... -1.700 0.003
intraductal papillary-mucinous carcinoma... -1.300 0.012
lung cancer 1.100 0.013
interstitial cystitis 1.300 0.004
adult high grade glioma -1.200 0.001
Breast cancer -1.700 0.000
progressive supranuclear palsy -1.100 0.006
ovarian cancer 2.200 0.001
pituitary cancer -1.700 0.000
Down syndrome 1.200 0.005
dermatomyositis 1.100 0.004

Gene RIF (49)

PMID Text
26632716 LRIG1 expression was associated with pathological type, differentiation status, and stage of Non-small Cell Lung Cancer. The result showed that LRIG1 was an independent prognostic factor for OS of NSCLC patients.
26159916 LRIG1 is frequently methylated in human CRC and consequent mRNA and protein downregulation may contribute to tumor growth by activating EGFR/AKT signaling
26148232 ERa-dependent expression of LRIG1 dampens ErbB3 signaling in luminal breast cancer cells, and by blocking ERa activity with fulvestrant, LRIG1 is decreased thus permitting ErbB3 accumulation, enhanced ErbB3 signaling to cell survival pathways
25960225 MiR-20a mediated temozolomide-resistance in glioblastoma cells through negatively regulating LRIG1 expression.
25860915 The inhibitory effects of LRIG1 are most likely mediated by suppression of the EGFR/PI3K/AKT pathway and epithelial-mesenchymal transition (EMT) process.
25813475 These findings demonstrate that LRIG1 is an independent prognostic factor in patients with non-small cell lung cancer
25801120 Results showed that leucine-rich repeats and immunoglobulin-like domains can reverse multidrug resistance in glioblastoma, by negatively regulating epidermal growth factor receptor.
25794708 a subset of human duodenal tumors exhibited features of LRIG1(-/-) adenomas, including loss of LRIG1, gastric metaplasia (MUCIN5AC and MUCIN6), and increased amphiregulin and Egfr activity.
25695283 Based on these results, we concluded that the upregulation of LRIG1 expression inhibited the EGFR signaling pathway, activated the mitochondrial pathway of apoptosis and eventually increased the sensitivity of bladder cancer cells to CDDP.
25449296 LRIG1 can enhance chemosensitivity in glioblastoma by inhibition of BCL-2 and MnSOD
More...

AA Sequence

MARPVRGGLGAPRRSPCLLLLWLLLLRLEPVTAAAGPRAPCAAACTCAGDSLDCGGRGLAALPGDLPSWT      1 - 70
RSLNLSYNKLSEIDPAGFEDLPNLQEVYLNNNELTAVPSLGAASSHVVSLFLQHNKIRSVEGSQLKAYLS     71 - 140
LEVLDLSLNNITEVRNTCFPHGPPIKELNLAGNRIGTLELGAFDGLSRSLLTLRLSKNRITQLPVRAFKL    141 - 210
PRLTQLDLNRNRIRLIEGLTFQGLNSLEVLKLQRNNISKLTDGAFWGLSKMHVLHLEYNSLVEVNSGSLY    211 - 280
GLTALHQLHLSNNSIARIHRKGWSFCQKLHELVLSFNNLTRLDEESLAELSSLSVLRLSHNSISHIAEGA    281 - 350
FKGLRSLRVLDLDHNEISGTIEDTSGAFSGLDSLSKLTLFGNKIKSVAKRAFSGLEGLEHLNLGGNAIRS    351 - 420
VQFDAFVKMKNLKELHISSDSFLCDCQLKWLPPWLIGRMLQAFVTATCAHPESLKGQSIFSVPPESFVCD    421 - 490
DFLKPQIITQPETTMAMVGKDIRFTCSAASSSSSPMTFAWKKDNEVLTNADMENFVHVHAQDGEVMEYTT    491 - 560
ILHLRQVTFGHEGRYQCVITNHFGSTYSHKARLTVNVLPSFTKTPHDITIRTTTMARLECAATGHPNPQI    561 - 630
AWQKDGGTDFPAARERRMHVMPDDDVFFITDVKIDDAGVYSCTAQNSAGSISANATLTVLETPSLVVPLE    631 - 700
DRVVSVGETVALQCKATGNPPPRITWFKGDRPLSLTERHHLTPDNQLLVVQNVVAEDAGRYTCEMSNTLG    701 - 770
TERAHSQLSVLPAAGCRKDGTTVGIFTIAVVSSIVLTSLVWVCIIYQTRKKSEEYSVTNTDETVVPPDVP    771 - 840
SYLSSQGTLSDRQETVVRTEGGPQANGHIESNGVCPRDASHFPEPDTHSVACRQPKLCAGSAYHKEPWKA    841 - 910
MEKAEGTPGPHKMEHGGRVVCSDCNTEVDCYSRGQAFHPQPVSRDSAQPSAPNGPEPGGSDQEHSPHHQC    911 - 980
SRTAAGSCPECQGSLYPSNHDRMLTAVKKKPMASLDGKGDSSWTLARLYHPDSTELQPASSLTSGSPERA    981 - 1050
EAQYLLVSNGHLPKACDASPESTPLTGQLPGKQRVPLLLAPKS                              1051 - 1093
//

Text Mined References (61)

PMID Year Title
26632716 2015 Expression of LRIG1 is Associated With Good Prognosis for Human Non-small Cell Lung Cancer.
26159916 2015 LRIG1, a 3p tumor suppressor, represses EGFR signaling and is a novel epigenetic silenced gene in colorectal cancer.
26148232 2016 Decreased LRIG1 in fulvestrant-treated luminal breast cancer cells permits ErbB3 upregulation and increased growth.
25960225 2015 miR-20a mediates temozolomide-resistance in glioblastoma cells via negatively regulating LRIG1 expression.
25860915 2015 LRIG1 inhibits hypoxia-induced vasculogenic mimicry formation via suppression of the EGFR/PI3K/AKT pathway and epithelial-to-mesenchymal transition in human glioma SHG-44 cells.
25813475 2015 LRIG1 is a prognostic biomarker in non-small cell lung cancer.
25801120 2015 LRIG1, human EGFR inhibitor, reverses multidrug resistance through modulation of ABCB1 and ABCG2.
25794708 2015 Loss of Lrig1 leads to expansion of Brunner glands followed by duodenal adenomas with gastric metaplasia.
25695283 2015 Adenovirus-mediated LRIG1 expression enhances the chemosensitivity of bladder cancer cells to cisplatin.
25449296 2015 LRIG1 improves chemosensitivity through inhibition of BCL-2 and MnSOD in glioblastoma.
More...