Property Summary

NCBI Gene PubMed Count 67
PubMed Score 88.36
PubTator Score 73.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -1.200 7.2e-04
astrocytic glioma 1.900 1.9e-02
atypical teratoid / rhabdoid tumor -1.400 5.5e-03
Breast cancer 1.200 3.8e-02
dermatomyositis 1.100 3.8e-03
Down syndrome 1.200 4.9e-03
ependymoma 1.700 7.8e-03
glioblastoma 1.200 2.7e-03
group 4 medulloblastoma -1.900 5.5e-07
interstitial cystitis 1.300 4.1e-03
intraductal papillary-mucinous adenoma (... -1.700 2.5e-03
intraductal papillary-mucinous carcinoma... -1.300 1.2e-02
lung cancer 1.100 1.3e-02
malignant mesothelioma 1.300 1.1e-05
medulloblastoma, large-cell -1.800 1.5e-05
oligodendroglioma 2.400 5.3e-03
osteosarcoma -2.172 2.0e-02
ovarian cancer 2.200 1.2e-03
pituitary cancer -1.700 1.1e-04
progressive supranuclear palsy -1.100 6.5e-03
psoriasis -1.200 3.7e-09
tuberculosis -1.500 4.6e-06

Protein-protein Interaction (10)

Gene RIF (56)

AA Sequence

MARPVRGGLGAPRRSPCLLLLWLLLLRLEPVTAAAGPRAPCAAACTCAGDSLDCGGRGLAALPGDLPSWT      1 - 70
RSLNLSYNKLSEIDPAGFEDLPNLQEVYLNNNELTAVPSLGAASSHVVSLFLQHNKIRSVEGSQLKAYLS     71 - 140
LEVLDLSLNNITEVRNTCFPHGPPIKELNLAGNRIGTLELGAFDGLSRSLLTLRLSKNRITQLPVRAFKL    141 - 210
PRLTQLDLNRNRIRLIEGLTFQGLNSLEVLKLQRNNISKLTDGAFWGLSKMHVLHLEYNSLVEVNSGSLY    211 - 280
GLTALHQLHLSNNSIARIHRKGWSFCQKLHELVLSFNNLTRLDEESLAELSSLSVLRLSHNSISHIAEGA    281 - 350
FKGLRSLRVLDLDHNEISGTIEDTSGAFSGLDSLSKLTLFGNKIKSVAKRAFSGLEGLEHLNLGGNAIRS    351 - 420
VQFDAFVKMKNLKELHISSDSFLCDCQLKWLPPWLIGRMLQAFVTATCAHPESLKGQSIFSVPPESFVCD    421 - 490
DFLKPQIITQPETTMAMVGKDIRFTCSAASSSSSPMTFAWKKDNEVLTNADMENFVHVHAQDGEVMEYTT    491 - 560
ILHLRQVTFGHEGRYQCVITNHFGSTYSHKARLTVNVLPSFTKTPHDITIRTTTMARLECAATGHPNPQI    561 - 630
AWQKDGGTDFPAARERRMHVMPDDDVFFITDVKIDDAGVYSCTAQNSAGSISANATLTVLETPSLVVPLE    631 - 700
DRVVSVGETVALQCKATGNPPPRITWFKGDRPLSLTERHHLTPDNQLLVVQNVVAEDAGRYTCEMSNTLG    701 - 770
TERAHSQLSVLPAAGCRKDGTTVGIFTIAVVSSIVLTSLVWVCIIYQTRKKSEEYSVTNTDETVVPPDVP    771 - 840
SYLSSQGTLSDRQETVVRTEGGPQANGHIESNGVCPRDASHFPEPDTHSVACRQPKLCAGSAYHKEPWKA    841 - 910
MEKAEGTPGPHKMEHGGRVVCSDCNTEVDCYSRGQAFHPQPVSRDSAQPSAPNGPEPGGSDQEHSPHHQC    911 - 980
SRTAAGSCPECQGSLYPSNHDRMLTAVKKKPMASLDGKGDSSWTLARLYHPDSTELQPASSLTSGSPERA    981 - 1050
EAQYLLVSNGHLPKACDASPESTPLTGQLPGKQRVPLLLAPKS                              1051 - 1093
//

Text Mined References (69)

PMID Year Title