Property Summary

NCBI Gene PubMed Count 46
Grant Count 205
R01 Count 104
Funding $41,205,068.25
PubMed Score 549.45
PubTator Score 251.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
colon cancer 4.100 0.001

Synonym

Accession Q96J94 A4F266 O95404 Q8NA60 Q8TBY5 Q96JD5
Symbols HIWI
MIWI
PIWI
CT80.1

Gene

PDB

2L5C   2L5D   3O3I   3O6E   3O7V  

Gene RIF (37)

PMID Text
26317901 Our study reveals a novel mechanism for PIWIL1 in tumorigenesis.
26056945 results suggested that Piwil1 caused the loss of PTEN expression through DNMT1-mediated PTEN hypermethylation
26026091 Our results indicate a reciprocal regulation between HIWI, HILI and some CSCs markers in colorectal cancer
25742785 PIWIL1 expression emerged as an independent prognostic marker in non-small cell lung cancer.
25630839 Among patients with high let-7a expression, those with medium HIWI had an increased risk of death compared to those with low HIWI (HR = 2.62, 95% CI: 1.30-5.30).
25370791 Hiwi downregulation mediated by shRNA reduce the proliferation and migration of HCC cells.
25313140 Evidence of an active PIWI-interacting small non-coding RNAs pathway in BC suggests that these small non-coding RNAs do exert transcriptional and post-transcriptional gene regulatory actions also in cancer cells.
25292027 Overexpression of hiwi promotes growth of breast cancer cells.
25269862 These findings suggest that HIWI is an oncogene involved in the progression of glioma.
25119492 Results show that HIWI is highly expressed in high-grade squamous intraepithelial lesions and cervical cancer tissues suggesting its participation in the carcinogenesis of cervical cancer.
More...

AA Sequence

MTGRARARARGRARGQETAQLVGSTASQQPGYIQPRPQPPPAEGELFGRGRQRGTAGGTAKSQGLQISAG      1 - 70
FQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLM     71 - 140
EARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQ    141 - 210
FYNIIFRRLLKIMNLQQIGRNYYNPNDPIDIPSHRLVIWPGFTTSILQYENSIMLCTDVSHKVLRSETVL    211 - 280
DFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQY    281 - 350
NQEITDLKQPVLVSQPKRRRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQRE    351 - 420
VGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISV    421 - 490
KPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLL    491 - 560
SSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVG    561 - 630
IDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVY    631 - 700
RDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYNPRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVT    701 - 770
RPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAF    771 - 840
LVGQSIHREPNLSLSNRLYYL                                                     841 - 861
//

Text Mined References (48)

PMID Year Title
26317901 2015 PIWIL1 destabilizes microtubule by suppressing phosphorylation at Ser16 and RLIM-mediated degradation of Stathmin1.
26056945 2015 Piwil1 causes epigenetic alteration of PTEN gene via upregulation of DNA methyltransferase in type I endometrial cancer.
26026091 2015 Correlation of HIWI and HILI Expression with Cancer Stem Cell Markers in Colorectal Cancer.
25742785 2015 The significance of PIWI family expression in human lung embryogenesis and non-small cell lung cancer.
25630839 2016 MicroRNA let-7a modifies the effect of self-renewal gene HIWI on patient survival of epithelial ovarian cancer.
25370791 2015 Hiwi downregulation, mediated by shRNA, reduces the proliferation and migration of human hepatocellular carcinoma cells.
25313140 2014 RNA sequencing identifies specific PIWI-interacting small non-coding RNA expression patterns in breast cancer.
25292027 2014 Overexpression of hiwi promotes growth of human breast cancer cells.
25269862 2014 Silencing HIWI suppresses the growth, invasion and migration of glioma cells.
25119492 2014 Hiwi facilitates chemoresistance as a cancer stem cell marker in cervical cancer.
More...