Property Summary

NCBI Gene PubMed Count 63
Grant Count 118
R01 Count 77
Funding $8,100,600.09
PubMed Score 108.83
PubTator Score 100.06

Knowledge Summary

Patent (1,360)

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... 2.100 0.020
Endometriosis -1.304 0.015
ovarian cancer -1.400 0.000

Synonym

Accession Q96J92 B0LPI0 Q8N8X3 Q8N8Z2 Q96DT8 Q9BYS5
Symbols PHA2B
PRKWNK4

Gene

PDB

2V3S   4CHB   4CH9  

Gene RIF (55)

PMID Text
26435498 Akt and PKA phosphorylated KLHL3 at S433, and phosphorylation of KLHL3 by PKA inhibited WNK4 degradation.
26349538 Data indicate that WNK lysine deficient protein kinase 4 protein (WNK4) was degraded not only by proteasomes but also by atypical protein kinase C scaffold protein p62 (p62)-kelch-like 3 protein (KLHL3)-mediated selective autophagy.
25805816 WNK4 is a substrate of SFKs and the association of c-Src and PTP-1D with WNK4 at Tyr(1092) and Tyr(1143) plays an important role in modulating the inhibitory effect of WNK4 on ROMK
25266424 this meta-analysis suggested that WNK4 G1155942T and C6749T gene polymorphisms may contribute to the susceptibility and development of hypertension.
24518042 Regulation of WNK4 by CUL3 and its relationship to blood pressure regulation and electrolyte homeostasis. [Review]
23993962 WNK4 inhibits SNARE formation of syntaxin 13 with VAMP2.
23962426 analysis of how mutations of KLHL3 show less ability to ubiquitinate WNK4 because of KLHL3's low stability and/or decreased binding to CUL3 or WNK4
23885063 WNK4 inhibits Large-conductance, Ca(2 )-activated K( ) channel activity, in part, by increasing channel degradation through an ubiquitin-dependent pathway.
23665031 KLHL3 is a substrate adaptor for WNK4 in a ubiquitin E3 ligase complex
23594824 WNK4 inhibits ENaC channel activity independently of Nedd4-2-mediated ENaC ubiquitination.
More...

AA Sequence

MLASPATETTVLMSQTEADLALRPPPPLGTAGQPRLGPPPRRARRFSGKAEPRPRSSRLSRRSSVDLGLL      1 - 70
SSWSLPASPAPDPPDPPDSAGPGPARSPPPSSKEPPEGTWTEGAPVKAAEDSARPELPDSAVGPGSREPL     71 - 140
RVPEAVALERRREQEEKEDMETQAVATSPDGRYLKFDIEIGRGSFKTVYRGLDTDTTVEVAWCELQTRKL    141 - 210
SRAERQRFSEEVEMLKGLQHPNIVRFYDSWKSVLRGQVCIVLVTELMTSGTLKTYLRRFREMKPRVLQRW    211 - 280
SRQILRGLHFLHSRVPPILHRDLKCDNVFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEE    281 - 350
KYDEAVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGRKPNSFHKVKIPEVKEIIEGCIRTDKNER    351 - 420
FTIQDLLAHAFFREERGVHVELAEEDDGEKPGLKLWLRMEDARRGGRPRDNQAIEFLFQLGRDAAEEVAQ    421 - 490
EMVALGLVCEADYQPVARAVRERVAAIQRKREKLRKARELEALPPEPGPPPATVPMAPGPPSVFPPEPEE    491 - 560
PEADQHQPFLFRHASYSSTTSDCETDGYLSSSGFLDASDPALQPPGGVPSSLAESHLCLPSAFALSIPRS    561 - 630
GPGSDFSPGDSYASDAASGLSDVGEGMGQMRRPPGRNLRRRPRSRLRVTSVSDQNDRVVECQLQTHNSKM    631 - 700
VTFRFDLDGDSPEEIAAAMVYNEFILPSERDGFLRRIREIIQRVETLLKRDTGPMEAAEDTLSPQEEPAP    701 - 770
LPALPVPLPDPSNEELQSSTSLEHRSWTAFSTSSSSPGTPLSPGNPFSPGTPISPGPIFPITSPPCHPSP    771 - 840
SPFSPISSQVSSNPSPHPTSSPLPFSSSTPEFPVPLSQCPWSSLPTTSPPTFSPTCSQVTLSSPFFPPCP    841 - 910
STSSFPSTTAAPLLSLASAFSLAVMTVAQSLLSPSPGLLSQSPPAPPSPLPSLPLPPPVAPGGQESPSPH    911 - 980
TAEVESEASPPPARPLPGEARLAPISEEGKPQLVGRFQVTSSKEPAEPLPLQPTSPTLSGSPKPSTPQLT    981 - 1050
SESSDTEDSAGGGPETREALAESDRAAEGLGAGVEEEGDDGKEPQVGGSPQPLSHPSPVWMNYSYSSLCL   1051 - 1120
SSEESESSGEDEEFWAELQSLRQKHLSEVETLQTLQKKEIEDLYSRLGKQPPPGIVAPAAMLSSRQRRLS   1121 - 1190
KGSFPTSRRNSLQRSEPPGPGIMRRNSLSGSSTGSQEQRASKGVTFAGDVGRM                    1191 - 1243
//

Text Mined References (66)

PMID Year Title
26435498 2015 Impaired degradation of WNK by Akt and PKA phosphorylation of KLHL3.
26349538 2015 Involvement of selective autophagy mediated by p62/SQSTM1 in KLHL3-dependent WNK4 degradation.
25805816 2015 Src-family protein tyrosine kinase phosphorylates WNK4 and modulates its inhibitory effect on KCNJ1 (ROMK).
25266424 2014 Comprehensive assessment of the association of WNK4 polymorphisms with hypertension: evidence from a meta-analysis.
24518042 2014 Insights in cullin 3/WNK4 and its relationship to blood pressure regulation and electrolyte homeostasis.
23993962 2013 WNK4 inhibits plasma membrane targeting of NCC through regulation of syntaxin13 SNARE formation.
23962426 2013 Decrease of WNK4 ubiquitination by disease-causing mutations of KLHL3 through different molecular mechanisms.
23885063 2013 Regulation of large-conductance Ca2+-activated K+ channels by WNK4 kinase.
23838290 2013 KLHL2 interacts with and ubiquitinates WNK kinases.
23665031 2013 Disease-causing mutations in KLHL3 impair its effect on WNK4 degradation.
More...