Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.71
PubTator Score 8.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
active Crohn's disease 1.369 8.9e-03
acute myeloid leukemia -1.900 6.5e-03
adult high grade glioma 1.600 8.6e-05
Astrocytoma, Pilocytic 1.300 1.1e-05
Atopic dermatitis 1.500 1.9e-03
Breast cancer 1.300 1.7e-04
breast carcinoma 1.100 1.9e-24
cystic fibrosis 1.900 8.3e-04
gastric carcinoma 1.300 5.0e-02
glioblastoma 1.500 9.9e-07
Hydrolethalus syndrome -2.651 2.0e-02
interstitial cystitis 2.100 7.2e-03
intraductal papillary-mucinous neoplasm ... 2.400 1.6e-03
invasive ductal carcinoma 1.613 8.0e-04
juvenile dermatomyositis 2.924 8.1e-15
lung carcinoma -1.200 4.1e-08
osteosarcoma -2.498 2.8e-03
ovarian cancer -1.100 1.2e-02
pancreatic cancer -1.700 1.6e-02
pancreatic carcinoma -1.700 1.6e-02
primary pancreatic ductal adenocarcinoma 1.685 1.1e-03
primary Sjogren syndrome 2.000 7.9e-06
psoriasis 2.500 1.7e-37
subependymal giant cell astrocytoma 1.640 2.6e-03
tuberculosis 1.400 2.5e-03
ulcerative colitis 1.300 7.1e-04

Synonym

Accession Q96J88 Q8IVC7 Q8NDQ7
Symbols BRESI1

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

 Compartment GO Term (1)

Gene RIF (3)

AA Sequence

MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLI      1 - 70
APNINRRNEIQRIAEQELANLEKWKEQNRAKPVHLVPRRLGGSQSETEVRQKQQLQLMQSKYKQKLKREE     71 - 140
SVRIKKEAEEAELQKMKAIQREKSNKLEEKKRLQENLRREAFREHQQYKTAEFLSKLNTESPDRSACQSA    141 - 210
VCGPQSSTWKLPILPRDHSWARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTE    211 - 280
HRRVNNAFLDRLQGKSQPGGLEQSGGCWNMNSGNSWGI                                    281 - 318
//

Text Mined References (15)

PMID Year Title