Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.82
PubTator Score 8.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
pancreatic cancer -1.700 0.016
osteosarcoma -2.498 0.003
glioblastoma 1.600 0.001
juvenile dermatomyositis 2.924 0.000
Atopic dermatitis 1.500 0.002
primary pancreatic ductal adenocarcinoma 1.685 0.001
tuberculosis 1.400 0.003
intraductal papillary-mucinous neoplasm ... 2.400 0.002
Hydrolethalus syndrome -2.651 0.020
active Crohn's disease 1.369 0.009
interstitial cystitis 2.100 0.007
cystic fibrosis 1.900 0.001
adult high grade glioma 1.600 0.000
pilocytic astrocytoma 1.300 0.000
primary Sjogren syndrome 2.000 0.000
pancreatic carcinoma -1.700 0.016
psoriasis 2.500 0.000
subependymal giant cell astrocytoma 1.640 0.003
invasive ductal carcinoma 1.900 0.001
lung carcinoma -1.200 0.000
breast carcinoma 1.100 0.000
Breast cancer 1.300 0.000
gastric carcinoma 1.300 0.050
acute myeloid leukemia -1.900 0.007
ulcerative colitis 1.300 0.001
ovarian cancer 2.700 0.000

Synonym

Accession Q96J88 Q8IVC7 Q8NDQ7
Symbols BRESI1

Gene

 Compartment GO Term (0)

Gene RIF (3)

PMID Text
24096480 A novel KLF8 to EPSTI1 to VCP to NF-kappaB signaling mechanism potentially critical for breast cancer invasion and metastasis.
23898208 HIV-1 Tat upregulates the expression of epithelial stromal interaction 1 (EPSTI1) in human primary T cells
20133812 These observations implicate EPSTI1 as a hitherto unappreciated regulator of tumor cell properties.

AA Sequence

MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLI      1 - 70
APNINRRNEIQRIAEQELANLEKWKEQNRAKPVHLVPRRLGGSQSETEVRQKQQLQLMQSKYKQKLKREE     71 - 140
SVRIKKEAEEAELQKMKAIQREKSNKLEEKKRLQENLRREAFREHQQYKTAEFLSKLNTESPDRSACQSA    141 - 210
VCGPQSSTWKLPILPRDHSWARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTE    211 - 280
HRRVNNAFLDRLQGKSQPGGLEQSGGCWNMNSGNSWGI                                    281 - 318
//

Text Mined References (15)

PMID Year Title
24096480 2014 Identification of epithelial stromal interaction 1 as a novel effector downstream of Krüppel-like factor 8 in breast cancer invasion and metastasis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20133812 2010 Epithelial-stromal interaction 1 (EPSTI1) substitutes for peritumoral fibroblasts in the tumor microenvironment.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16769699 2005 Isolation and expression profiling of genes upregulated in the peripheral blood cells of systemic lupus erythematosus patients.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
More...