Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.33
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Expression

Synonym

Accession Q96J87 B4DG28 B4DJB6 Q6PII4 Q6ZNJ7 Q8N607 CELF-6
Symbols BRUNOL6

Gene

PDB

2DGQ  

  Ortholog (3)

Species Source
Mouse EggNOG Inparanoid
Cow EggNOG Inparanoid
Pig EggNOG Inparanoid

Gene RIF (2)

PMID Text
23407934 Analysis of common variants near the corresponding genes implicated the RNA binding protein CELF6 in autism risk
14761971 CELF6 is a member of the CELF family of RNA-binding proteins that regulates muscle-specific splicing enhancer-dependent alternative splicing

AA Sequence

MAAAPGGSAQPAGPGPRLGFSTADSGVGMSGLNPGPAVPMKDHDAIKLFVGQIPRGLDEQDLKPLFEEFG      1 - 70
RIYELTVLKDRLTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPAASEGRGEDRKLFVGM     71 - 140
LGKQQGEEDVRRLFQPFGHIEECTVLRSPDGTSKGCAFVKFGSQGEAQAAIRGLHGSRTMAGASSSLVVK    141 - 210
LADTDRERALRRMQQMAGHLGAFHPAPLPLGACGAYTTAILQHQAALLAAAQGPGLGPVAAVAAQMQHVA    211 - 280
AFSLVAAPLLPAAAANSPPGSGPGTLPGLPAPIGVNGFGPLTPQTNGQPGSDTLYNNGLSPYPAQSPGVA    281 - 350
DPLQQAYAGMHHYAAAYPSAYAPVSTAFPQQPSALPQQQREGPEGCNLFIYHLPQEFGDAELIQTFLPFG    351 - 420
AVVSAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQAMNGFQIGMKRLKVQLKRPKDANRPY             421 - 481
//

Text Mined References (9)

PMID Year Title
23407934 2013 The disruption of Celf6, a gene identified by translational profiling of serotonergic neurons, results in autism-related behaviors.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14761971 2004 CELF6, a member of the CELF family of RNA-binding proteins, regulates muscle-specific splicing enhancer-dependent alternative splicing.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
10893231 2000 A family of human RNA-binding proteins related to the Drosophila Bruno translational regulator.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.