Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.99
PubTator Score 4.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Gene RIF (2)

AA Sequence

MDAPRLPVRPGVLLPKLVLLFVYADDCLAQCGKDCKSYCCDGTTPYCCSYYAYIGNILSGTAIAGIVFGI      1 - 70
VFIMGVIAGIAICICMCMKNHRATRVGILRTTHINTVSSYPGPPPYGHDHEMEYCADLPPPYSPTPQGPA     71 - 140
QRSPPPPYPGNARK                                                            141 - 154
//

Text Mined References (11)

PMID Year Title