Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.84
PubTator Score 4.59

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
24981926 New CYYR1 alternative isoforms were identified and characterized.
17442112 A new "subtle" splicing isoform (CAG+) of CYYR1 mRNA, the sequence & expression of this gene were defined in a series of NE tumors. This CAG+ codon determines the presence of an Ala residue at the exon 3/exon 4 junction of the CYYR1 mRNA.

AA Sequence

MDAPRLPVRPGVLLPKLVLLFVYADDCLAQCGKDCKSYCCDGTTPYCCSYYAYIGNILSGTAIAGIVFGI      1 - 70
VFIMGVIAGIAICICMCMKNHRATRVGILRTTHINTVSSYPGPPPYGHDHEMEYCADLPPPYSPTPQGPA     71 - 140
QRSPPPPYPGNARK                                                            141 - 154
//

Text Mined References (11)

PMID Year Title
24981926 2014 Characterization of human gene locus CYYR1: a complex multi-transcript system.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17442112 2007 Sequence, "subtle" alternative splicing and expression of the CYYR1 (cysteine/tyrosine-rich 1) mRNA in human neuroendocrine tumors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12062809 2002 Cysteine and tyrosine-rich 1 (CYYR1), a novel unpredicted gene on human chromosome 21 (21q21.2), encodes a cysteine and tyrosine-rich protein and defines a new family of highly conserved vertebrate-specific genes.
12036297 2002 Nineteen additional unpredicted transcripts from human chromosome 21.
10830953 2000 The DNA sequence of human chromosome 21.
More...