Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.89
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 3.60093112452024E-11
ovarian cancer 8492 1.85130205352954E-9
medulloblastoma, large-cell 6234 2.5921805245276E-4
atypical teratoid / rhabdoid tumor 4369 0.00726612649609454
adult high grade glioma 2148 0.0115660709072134

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.007
medulloblastoma, large-cell 1.700 0.000
juvenile dermatomyositis -1.151 0.000
adult high grade glioma 1.200 0.012
ovarian cancer 1.600 0.000

Synonym

Accession Q96J77 Q5TCR3 Q5TCR4 Q5TCR5 Q8N4P5 Q8WWF7 Q96M09 hD55
Symbols hD55
NYDSP25

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG

 Compartment GO Term (0)

AA Sequence

MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALV      1 - 70
GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATFRSFEGLMGTIKSKVSGGKRAWP     71 - 140
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
16631610 2006 A testis-specific and testis developmentally regulated tumor protein D52 (TPD52)-like protein TPD52L3/hD55 interacts with TPD52 family proteins.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.