Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.39
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.200 1.2e-02
atypical teratoid / rhabdoid tumor 1.100 7.3e-03
juvenile dermatomyositis -1.151 3.6e-11
medulloblastoma, large-cell 1.700 2.6e-04
ovarian cancer 1.600 1.9e-09

Synonym

Accession Q96J77 Q5TCR3 Q5TCR4 Q5TCR5 Q8N4P5 Q8WWF7 Q96M09 hD55
Symbols hD55
NYDSP25

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

 Compartment GO Term (0)

AA Sequence

MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALV      1 - 70
GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATFRSFEGLMGTIKSKVSGGKRAWP     71 - 140
//

Text Mined References (9)

PMID Year Title