Property Summary

NCBI Gene PubMed Count 50
PubMed Score 54.74
PubTator Score 86.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q96J66 Q8TDJ0 Q96JA6 Q9BX80
Symbols WW
EWWD
MRP8

Gene

Gene RIF (42)

PMID Text
25896536 identified c.1637C>T (T546M), previously associated with 5-FU-related toxicity, as a novel functionally damaging ABCC11 variant exhibiting markedly reduced transport function of 5-FdUMP, the active cytotoxic metabolite of 5-FU. Detailed analysis of 14 subpopulations revealed highest allele frequencies of c.1637C>T in Europeans and Americans (up to 11%) compared with Africans and Asians (up to 3%).
25633187 The ABCC11 gene SNP of the 538 G>A allele was associated with a downregulation of the mRNA expression of ApoD in the apocrine glands, which may indicate a role for the ABCC11 gene in the mediation of osmidrosis
25501636 A single nucleotide polymorphism in ABCC11 affects the cerumen volatile organic compounds profiles of individuals from African, Caucasian, and Asian descent.
25471894 MRP8 elevated serum levels in patients with Behcet's disease indicate MRP8 role in the pathogenetic mechanisms of Behcet's disease.
25312864 study revealed a novel role of MRP8/14 in the autophagy-mediated elimination of intracellular BCG by promoting reactive oxygen species generation
25037196 Circulating MRP-8/14 is associated with TX-dependent platelet activation in ACS, even during low-dose aspirin treatment, suggesting a contribution of residual TX to MRP-8/14 shedding, which may further amplify platelet activation.
24533866 role in the generation of axillary malodour
24286299 Data suggest that tissue infiltrating macrophages secreting MRP8/14 may contribute to myositis, by driving the local production of cytokines directly from muscle.
24231443 MRP8/14 can activate cells by binding to TLR4, leading to the release of proinflammatory cytokines. These mediators can lead to increased disease activity in enthesitis-related arthritis.
24076068 ABCC11 gene SNP results in lower levels of axillary odour in the A/A homozygotes, but A/A subjects still produce noticeable amounts of axillary odour. Axillary skin metabolites/bacterial genera/personal hygiene behaviours are also influenced by this SNP.
More...

AA Sequence

MTRKRTYWVPNSSGGLVNRGIDIGDDMVSGLIYKTYTLQDGPWSQQERNPEAPGRAAVPPWGKYDAALRT      1 - 70
MIPFRPKPRFPAPQPLDNAGLFSYLTVSWLTPLMIQSLRSRLDENTIPPLSVHDASDKNVQRLHRLWEEE     71 - 140
VSRRGIEKASVLLVMLRFQRTRLIFDALLGICFCIASVLGPILIIPKILEYSEEQLGNVVHGVGLCFALF    141 - 210
LSECVKSLSFSSSWIINQRTAIRFRAAVSSFAFEKLIQFKSVIHITSGEAISFFTGDVNYLFEGVCYGPL    211 - 280
VLITCASLVICSISSYFIIGYTAFIAILCYLLVFPLAVFMTRMAVKAQHHTSEVSDQRIRVTSEVLTCIK    281 - 350
LIKMYTWEKPFAKIIEDLRRKERKLLEKCGLVQSLTSITLFIIPTVATAVWVLIHTSLKLKLTASMAFSM    351 - 420
LASLNLLRLSVFFVPIAVKGLTNSKSAVMRFKKFFLQESPVFYVQTLQDPSKALVFEEATLSWQQTCPGI    421 - 490
VNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINLVVSKGMMLGVCGNTGSGKSSLLSAILEE    491 - 560
MHLLEGSVGVQGSLAYVPQQAWIVSGNIRENILMGGAYDKARYLQVLHCCSLNRDLELLPFGDMTEIGER    561 - 630
GLNLSGGQKQRISLARAVYSDRQIYLLDDPLSAVDAHVGKHIFEECIKKTLRGKTVVLVTHQLQYLEFCG    631 - 700
QIILLENGKICENGTHSELMQKKGKYAQLIQKMHKEATSDMLQDTAKIAEKPKVESQALATSLEESLNGN    701 - 770
AVPEHQLTQEEEMEEGSLSWRVYHHYIQAAGGYMVSCIIFFFVVLIVFLTIFSFWWLSYWLEQGSGTNSS    771 - 840
RESNGTMADLGNIADNPQLSFYQLVYGLNALLLICVGVCSSGIFTKVTRKASTALHNKLFNKVFRCPMSF    841 - 910
FDTIPIGRLLNCFAGDLEQLDQLLPIFSEQFLVLSLMVIAVLLIVSVLSPYILLMGAIIMVICFIYYMMF    911 - 980
KKAIGVFKRLENYSRSPLFSHILNSLQGLSSIHVYGKTEDFISQFKRLTDAQNNYLLLFLSSTRWMALRL    981 - 1050
EIMTNLVTLAVALFVAFGISSTPYSFKVMAVNIVLQLASSFQATARIGLETEAQFTAVERILQYMKMCVS   1051 - 1120
EAPLHMEGTSCPQGWPQHGEIIFQDYHMKYRDNTPTVLHGINLTIRGHEVVGIVGRTGSGKSSLGMALFR   1121 - 1190
LVEPMAGRILIDGVDICSIGLEDLRSKLSVIPQDPVLLSGTIRFNLDPFDRHTDQQIWDALERTFLTKAI   1191 - 1260
SKFPKKLHTDVVENGGNFSVGERQLLCIARAVLRNSKIILIDEATASIDMETDTLIQRTIREAFQGCTVL   1261 - 1330
VIAHRVTTVLNCDHILVMGNGKVVEFDRPEVLRKKPGSLFAALMATATSSLR                     1331 - 1382
//

Text Mined References (50)

PMID Year Title
25896536 2016 Functional characterization of common protein variants in the efflux transporter ABCC11 and identification of T546M as functionally damaging variant.
25633187 2015 Association between the ABCC11 gene polymorphism and the expression of apolipoprotein D by the apocrine glands in axillary osmidrosis.
25501636 2015 Ethnic/racial and genetic influences on cerumen odorant profiles.
25471894 2015 Elevated serum levels of calprotectin (MRP8/MRP14) in patients with Behçet's disease and its association with disease activity and quality of life.
25312864 2015 MRP8/14 induces autophagy to eliminate intracellular Mycobacterium bovis BCG.
25187374 2015 Genome-wide association meta-analysis identifies novel variants associated with fasting plasma glucose in East Asians.
25037196 2014 Circulating myeloid-related protein-8/14 is related to thromboxane-dependent platelet activation in patients with acute coronary syndrome, with and without ongoing low-dose aspirin treatment.
24533866 2014 Glutathione-conjugated sulfanylalkanols are substrates for ABCC11 and ?-glutamyl transferase 1: a potential new pathway for the formation of odorant precursors in the apocrine sweat gland.
24286299 2013 Myeloid related protein induces muscle derived inflammatory mediators in juvenile dermatomyositis.
24231443 2014 TLR4 endogenous ligand MRP8/14 level in enthesitis-related arthritis and its association with disease activity and TLR4 expression.
More...