Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.13
PubTator Score 33.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
pancreatic cancer 1.200 0.001
malignant mesothelioma -1.500 0.000
osteosarcoma -1.591 0.000
glioblastoma 1.300 0.001
medulloblastoma, large-cell -1.400 0.001
primary pancreatic ductal adenocarcinoma 1.104 0.003
tuberculosis and treatment for 6 months -1.400 0.000
interstitial cystitis 1.100 0.000
pilocytic astrocytoma 1.200 0.000
pancreatic carcinoma 1.200 0.001
acute myeloid leukemia -1.100 0.008
ulcerative colitis 1.500 0.000
ovarian cancer -2.400 0.000
dermatomyositis 1.100 0.001

Gene RIF (1)

PMID Text
21642008 Increased surface thiol isomerase activity on platelets, compared with cells of the vascular wall, may explain the platelet-selective actions of S-nitrosoglutathione and help define its antithrombotic potential

AA Sequence

MVPAAGRRPPRVMRLLGWWQVLLWVLGLPVRGVEVAEESGRLWSEEQPAHPLQVGAVYLGEEELLHDPMG      1 - 70
QDRAAEEANAVLGLDTQGDHMVMLSVIPGEAEDKVSSEPSGVTCGAGGAEDSRCNVRESLFSLDGAGAHF     71 - 140
PDREEEYYTEPEVAESDAAPTEDSNNTESLKSPKVNCEERNITGLENFTLKILNMSQDLMDFLNPNGSDC    141 - 210
TLVLFYTPWCRFSASLAPHFNSLPRAFPALHFLALDASQHSSLSTRFGTVAVPNILLFQGAKPMARFNHT    211 - 280
DRTLETLKIFIFNQTGIEAKKNVVVTQADQIGPLPSTLIKSVDWLLVFSLFFLISFIMYATIRTESIRWL    281 - 350
IPGQEQEHVE                                                                351 - 360
//

Text Mined References (10)

PMID Year Title
21642008 2011 Cell surface thiol isomerases may explain the platelet-selective action of S-nitrosoglutathione.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18391951 2008 Many sequence variants affecting diversity of adult human height.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.