Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.13
PubTator Score 33.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia -1.100 7.6e-03
Astrocytoma, Pilocytic 1.200 1.6e-06
dermatomyositis 1.100 8.5e-04
glioblastoma 1.300 7.3e-04
interstitial cystitis 1.100 2.2e-04
malignant mesothelioma -1.500 2.4e-06
medulloblastoma, large-cell -1.400 6.4e-04
osteosarcoma -1.591 3.0e-04
ovarian cancer -2.400 2.3e-13
pancreatic cancer 1.200 1.1e-03
pancreatic carcinoma 1.200 1.1e-03
primary pancreatic ductal adenocarcinoma 1.104 2.5e-03
tuberculosis and treatment for 6 months -1.400 9.4e-05
ulcerative colitis 1.500 1.6e-04

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MVPAAGRRPPRVMRLLGWWQVLLWVLGLPVRGVEVAEESGRLWSEEQPAHPLQVGAVYLGEEELLHDPMG      1 - 70
QDRAAEEANAVLGLDTQGDHMVMLSVIPGEAEDKVSSEPSGVTCGAGGAEDSRCNVRESLFSLDGAGAHF     71 - 140
PDREEEYYTEPEVAESDAAPTEDSNNTESLKSPKVNCEERNITGLENFTLKILNMSQDLMDFLNPNGSDC    141 - 210
TLVLFYTPWCRFSASLAPHFNSLPRAFPALHFLALDASQHSSLSTRFGTVAVPNILLFQGAKPMARFNHT    211 - 280
DRTLETLKIFIFNQTGIEAKKNVVVTQADQIGPLPSTLIKSVDWLLVFSLFFLISFIMYATIRTESIRWL    281 - 350
IPGQEQEHVE                                                                351 - 360
//

Text Mined References (11)

PMID Year Title