Property Summary

NCBI Gene PubMed Count 96
PubMed Score 97.03
PubTator Score 489.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung cancer 2798 1.09718585257572E-20
atypical teratoid / rhabdoid tumor 4369 1.40340391442128E-5
ovarian cancer 8492 1.79408636326885E-5
medulloblastoma 1524 9.04326634121001E-5
glioblastoma 5572 1.3815172023023E-4
medulloblastoma, large-cell 6234 3.11637958114015E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.63619452931588E-4
psoriasis 6685 0.00181888378787354
osteosarcoma 7933 0.00436928943037726
primitive neuroectodermal tumor 3031 0.0103804421066892
astrocytic glioma 2241 0.012076698663184
oligodendroglioma 2849 0.0170946626470155
ependymoma 2514 0.0257359903427875
spina bifida 1064 0.0319890095256133
esophageal adenocarcinoma 737 0.0340886847860247
sarcoidosis 368 0.0458917442770244
Disease Target Count Z-score Confidence
Paraplegia 71 3.254 1.6

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.200 0.012
ependymoma -2.300 0.026
oligodendroglioma -2.100 0.017
esophageal adenocarcinoma -1.200 0.034
psoriasis 1.400 0.002
osteosarcoma 1.533 0.004
atypical teratoid / rhabdoid tumor -2.000 0.000
glioblastoma -1.700 0.000
medulloblastoma -1.900 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.300 0.010
non-small cell lung cancer 1.384 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.000
sarcoidosis 1.100 0.046
spina bifida -1.509 0.032
ovarian cancer 1.100 0.000

Synonym

Accession Q96J02 A6NEW4 B4E234 E1P5P3 F5H217 O43584 Q5QP37 Q5TEL0 Q96F66 Q9BY75 Q9H451 Q9H4U5 Itch
Symbols AIF4
AIP4
ADMFD
NAPP1

Gene

PANTHER Protein Class (2)

PDB

5C7M   4ROF   5CQ2   5DWS   5DZD   2DMV   2KYK   2NQ3   2P4R   2YSF   3TUG  

  Ortholog (12)

Gene RIF (76)

PMID Text
26854353 LRAD3 is a component of pathways that function effectively to modulate Itch and Nedd4 auto-ubiquitination and levels.
26613292 catalytic activity of Itch toward different SH3 domain-containing proteins was similar, except for beta-PIX that was not readily ubiquitylated even though it could interact with an affinity comparable to those of other substrates tested
26555021 Cytomegalovirus UL42 induced the ubiquitination and degradation of human Itch in virus-infected fibroblasts, and was partially colocalized with p62, a ubiquitin-binding protein, and CD63, a marker of lysosome and multivesicular bodies.
26245901 In the absence of Ndfip1, the Nedd4 family member Itch can bind an E2 but cannot accept ubiquitin onto its catalytic cysteine.
25815880 Upregulated microRNA-214 enhances cardiac injury by targeting ITCH during coxsackievirus infection.
25776495 Cell proliferation of hepatocellular carcinoma cells mediated by miR-411, is through suppression of ITCH expression.
25618271 ITCH up-regulation and LATS1 down-regulation were closely associated with tumorigenesis and progression of SCC
25518932 Results suggest that Itch is a positive regulator of the TGF-beta-mediated Smad signaling pathway via Smad7 ubiquitination and protein degradation.
25436413 these observations reveal that Itch and Yap1 have antagonistic roles in the regulation of ASPP2 protein stability through competing post-translational regulatory mechanism of ASPP2.
25350971 High ITCH expression enhances breast tumor progression by inhibiting the Hippo tumor suppressor pathway
More...

AA Sequence

MSDSGSQLGSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNTNSPKWKQPLT      1 - 70
VIVTPVSKLHFRVWSHQTLKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLD     71 - 140
GLQLESEVVTNGETTCSENGVSLCLPRLECNSAISAHCNLCLPGLSDSPISASRVAGFTGASQNDDGSRS    141 - 210
KDETRVSTNGSDDPEDAGAGENRRVSGNNSPSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGSPSATSES    211 - 280
DGSSTGSLPPTNTNTNTSEGATSGLIIPLTISGGSGPRPLNPVTQAPLPPGWEQRVDQHGRVYYVDHVEK    281 - 350
RTTWDRPEPLPPGWERRVDNMGRIYYVDHFTRTTTWQRPTLESVRNYEQWQLQRSQLQGAMQQFNQRFIY    351 - 420
GNQDLFATSQSKEFDPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQLNEKPLPEGWEMRFTV    421 - 490
DGIPYFVDHNRRTTTYIDPRTGKSALDNGPQIAYVRDFKAKVQYFRFWCQQLAMPQHIKITVTRKTLFED    491 - 560
SFQQIMSFSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYI    561 - 630
NPDHLKYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPEFYNSLIWVKENNIEECD    631 - 700
LEMYFSVDKEILGEIKSHDLKPNGGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQYL    701 - 770
QYFDAKELEVLLCGMQEIDLNDWQRHAIYRHYARTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVG    771 - 840
GFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE           841 - 903
//

Text Mined References (106)

PMID Year Title
26854353 2016 Regulation of Itch and Nedd4 E3 Ligase Activity and Degradation by LRAD3.
26613292 2015 Multiple Src Homology 3 Binding to the Ubiquitin Ligase Itch Conserved Proline-Rich Region.
26555021 2016 Degradation of host ubiquitin E3 ligase Itch by human cytomegalovirus UL42.
26245901 2015 Itch WW Domains Inhibit Its E3 Ubiquitin Ligase Activity by Blocking E2-E3 Ligase Trans-thiolation.
26110611 2015 cir-ITCH plays an inhibitory role in colorectal cancer by regulating the Wnt/?-catenin pathway.
25815880 2015 Upregulated microRNA-214 enhances cardiac injury by targeting ITCH during coxsackievirus infection.
25776495 2015 miR-411 regulated ITCH expression and promoted cell proliferation in human hepatocellular carcinoma cells.
25631046 2015 Nedd4 family interacting protein 1 (Ndfip1) is required for ubiquitination and nuclear trafficking of BRCA1-associated ATM activator 1 (BRAT1) during the DNA damage response.
25618271 2014 Up-regulation of ITCH is associated with down-regulation of LATS1 during tumorigenesis and progression of cervical squamous cell carcinoma.
25518932 2015 Itch E3 ubiquitin ligase positively regulates TGF-? signaling to EMT via Smad7 ubiquitination.
More...