Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.62
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (14)

Gene RIF (1)

AA Sequence

MAVPAAAMGPSALGQSGPGSMAPWCSVSSGPSRYVLGMQELFRGHSKTREFLAHSAKVHSVAWSCDGRRL      1 - 70
ASGSFDKTASVFLLEKDRLVKENNYRGHGDSVDQLCWHPSNPDLFVTASGDKTIRIWDVRTTKCIATVNT     71 - 140
KGENINICWSPDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLTNGNGCINILS    141 - 210
YPELKPVQSINAHPSNCICIKFDPMGKYFATGSADALVSLWDVDELVCVRCFSRLDWPVRTLSFSHDGKM    211 - 280
LASASEDHFIDIAEVETGDKLWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPND    281 - 350
S//

Text Mined References (13)

PMID Year Title