Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.42
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96J01 Q6NZ53 Tho3
Symbols THO3
hTREX45

Gene

Gene RIF (1)

PMID Text
15998806 recruitment of the human TREX complex to spliced mRNA is not directly coupled to transcription, but is instead coupled to transcription indirectly through splicing

AA Sequence

MAVPAAAMGPSALGQSGPGSMAPWCSVSSGPSRYVLGMQELFRGHSKTREFLAHSAKVHSVAWSCDGRRL      1 - 70
ASGSFDKTASVFLLEKDRLVKENNYRGHGDSVDQLCWHPSNPDLFVTASGDKTIRIWDVRTTKCIATVNT     71 - 140
KGENINICWSPDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLTNGNGCINILS    141 - 210
YPELKPVQSINAHPSNCICIKFDPMGKYFATGSADALVSLWDVDELVCVRCFSRLDWPVRTLSFSHDGKM    211 - 280
LASASEDHFIDIAEVETGDKLWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPND    281 - 350
S//

Text Mined References (13)

PMID Year Title
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
23222130 2013 Aly and THO are required for assembly of the human TREX complex and association of TREX components with the spliced mRNA.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22178508 2012 mRNA export and the TREX complex.
21269460 2011 Initial characterization of the human central proteome.
18974867 2008 Recruitment of the complete hTREX complex is required for Kaposi's sarcoma-associated herpesvirus intronless mRNA nuclear export and virus replication.
17190602 2006 Human mRNA export machinery recruited to the 5' end of mRNA.
15998806 2005 Recruitment of the human TREX complex to mRNA during splicing.
15833825 2005 Linking transcriptional elongation and messenger RNA export to metastatic breast cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...