Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

 GO Process (1)

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MAGSYPEGAPAVLADKRQQFGSRFLRDPARVFHHNAWDNVEWSEEQAAAAERKVQENSIQRVCQEKQVDY      1 - 70
EINAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKSEVPECRNNEDGPGLIMEEQ     71 - 140
HKCSSKSLEHKTQTLPVEENVTQKISDLEICADEFPGSSATYRILEVGCGVGNTVFPILQTNNDPGLFVY    141 - 210
CCDFSSTAIELVQTNSEYDPSRCFAFVHDLCDEEKSYPVPKGSLDIIILIFVLSAIVPDKMQKAINRLSR    211 - 280
LLKPGGMMLLRDYGRYDMAQLRFKKGQCLSGNFYVRGDGTRVYFFTQEELDTLFTTAGLEKVQNLVDRRL    281 - 350
QVNRGKQLTMYRVWIQCKYCKPLLSSTS                                              351 - 378
//

Text Mined References (11)

PMID Year Title