Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.100 2.3e-03
intraductal papillary-mucinous carcinoma... 1.300 2.0e-03
medulloblastoma, large-cell -1.200 7.0e-04
psoriasis -1.900 1.3e-04
Rheumatoid arthritis 1.300 3.8e-02

AA Sequence

MKRVNSCVKSDEHVLEELETEGERQLKSLLQHQLDTSVSIEECMSKKESFAPGTMYKPFGKEAAGTMTLS      1 - 70
QFQTLHEKDQETASLRELGLNETEILIWKSHVSGEKKTKLRATPEAIQNRLQDIEERISERQRILCLPQR     71 - 140
FAKSKQLTRREMEIEKSLFQGADRHSFLKALYYQDEPQKKNKGDPMNNLESFYQEMIMKKRLEEFQLMRG    141 - 210
EPFASHSLVSATSVGDSGTAESPSLLQDKGKQAAQGKGPSLHVANVIDFSPEQCWTGPKKLTQPIEFVPE    211 - 280
DEIQRNRLSEEEIRKIPMFSSYNPGEPNKVLYLKNLSPRVTERDLVSLFARFQEKKGPPIQFRMMTGRMR    281 - 350
GQAFITFPNKEIAWQALHLVNGYKLHGKILVIEFGKNKKQRSNLQATSLISCATGSTTEISGS           351 - 413
//

Text Mined References (9)

PMID Year Title