Property Summary

NCBI Gene PubMed Count 96
Grant Count 253
R01 Count 181
Funding $21,309,158.43
PubMed Score 103.53
PubTator Score 118.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96IZ0 O75796 Q6FHY9 Q8N700
Symbols PAR4
Par-4

Gene

PDB

2JK9  

Gene RIF (83)

PMID Text
26977019 Decreased PAR4 expression in breast cancer is associated with shorter survival. PAR4 suppresses growth and invasiveness of breast cancer cells.
26246468 Authors determined that PAR-4 induces cell apoptosis in response to stimuli, in vitro, but is also involved in the relocation of GRP78 from endoplasmic reticulum to the cell surface of ovarian cancer cell line.
25670650 These results suggest that Porphyromonas gingivalis activates PAR4 signaling pathways, leading proMMP9 over-expression and cellular invasion in oral squamous cell carcinoma cells.
25495701 PAR1-platelet releasate enhances vasculogenesis more potently than PAR4-platelet releasate, and the enhancements require a cooperation of multiple platelet-derived angiogenic regulators.
25373316 Data indicate that PAR1 and PAR4 activate common promigratory signalling pathways in Hep3B liver carcinoma cells including activation of the receptor tyrosine kinases Met and PDGFR, the formation of ROS and the inactivation of PTP1B.
25297082 These results indicate that the expression of PAR1 and PAR2 in esophageal squamous cell carcinoma is increased but PAR4 is decreased.
25195896 C-terminus of the rat homologue of Par-4 was crystallized and a 3.7 A resolution X-ray diffraction data set was collected
25001535 The cancer cell specific activity of Par-4 is elicited through intracellular as well as extracellular mechanisms.
24992930 a Par-4 mutant that is unable to bind Fbxo45 is stabilized and further enhances staurosporine-induced apoptosis.
24931006 our results indicate that the mechanism by which PAR-4 orchestrates the apoptotic process requires cleavage by caspase-8.
More...

AA Sequence

MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELN      1 - 70
NNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSS     71 - 140
GPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPG    141 - 210
SSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVV    211 - 280
RERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR              281 - 340
//

Text Mined References (103)

PMID Year Title
26977019 2016 Prostate Apoptosis Response-4 (PAR4) Suppresses Growth and Invasion of Breast Cancer Cells and Is Positively Associated with Patient Survival.
26246468 2015 Role of PAR-4 in ovarian cancer.
25670650 2015 Involvement of protease-activated receptor 4 in over-expression of matrix metalloproteinase 9 induced by Porphyromonas gingivalis.
25495701 2015 PAR1-stimulated platelet releasate promotes angiogenic activities of endothelial progenitor cells more potently than PAR4-stimulated platelet releasate.
25373316 2015 Proteinase-activated receptor 1- and 4-promoted migration of Hep3B hepatocellular carcinoma cells depends on ROS formation and RTK transactivation.
25297082 2014 Protease-activated receptor (PAR)1, PAR2 and PAR4 expressions in esophageal squamous cell carcinoma.
25195896 2014 Cloning, expression, purification, crystallization and preliminary crystallographic analysis of the C-terminal domain of Par-4 (PAWR).
25001535 2014 Cancer-selective apoptosis by tumor suppressor par-4.
24992930 2014 Fbxo45-mediated degradation of the tumor-suppressor Par-4 regulates cancer cell survival.
24931006 2014 Caspase-8-mediated PAR-4 cleavage is required for TNF?-induced apoptosis.
More...