Property Summary

NCBI Gene PubMed Count 110
PubMed Score 105.81
PubTator Score 118.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
acute myeloid leukemia -3.100 1.2e-02
adrenocortical carcinoma -1.281 3.3e-02
atypical teratoid / rhabdoid tumor 2.500 7.1e-07
Breast cancer -1.600 1.7e-11
cystic fibrosis -1.203 3.4e-05
ductal carcinoma in situ 1.100 1.9e-02
ependymoma 1.300 3.3e-04
glioblastoma 1.800 4.7e-04
group 3 medulloblastoma -1.600 2.4e-03
intraductal papillary-mucinous adenoma (... 1.100 7.2e-03
intraductal papillary-mucinous carcinoma... 1.400 4.0e-02
intraductal papillary-mucinous neoplasm ... 1.300 4.0e-03
invasive ductal carcinoma 1.900 2.0e-02
lung cancer 1.500 3.3e-03
malignant mesothelioma 1.100 1.9e-05
non-small cell lung cancer 1.501 1.5e-16
osteosarcoma -2.089 1.4e-02
ovarian cancer -2.000 2.6e-07
pediatric high grade glioma 1.200 2.1e-03
Pick disease 1.400 7.0e-04
Polycystic ovary syndrome -1.008 4.4e-02
primitive neuroectodermal tumor 1.200 4.4e-02
psoriasis 1.300 1.3e-04
spina bifida -2.606 3.1e-02

Gene RIF (89)

AA Sequence

MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELN      1 - 70
NNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSS     71 - 140
GPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPG    141 - 210
SSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVV    211 - 280
RERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR              281 - 340
//

Text Mined References (117)

PMID Year Title