Property Summary

NCBI Gene PubMed Count 190
Grant Count 50
R01 Count 21
Funding $5,895,906.36
PubMed Score 639.12
PubTator Score 514.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.384 0.022
non-small cell lung cancer -4.878 0.000
lung cancer -3.700 0.000
lung adenocarcinoma -3.300 0.000
lung carcinoma -1.500 0.003
ovarian cancer 1.200 0.000
psoriasis -1.500 0.000

Gene RIF (186)

PMID Text
26341360 Arg12-Glu28 and Cys383-Val401 in TAFI are involved in thrombomodulin-mediated TAFI activation. Gly205-Asp232 is involved in binding to thrombin.
26340515 Acute myocardial infarction patients have higher plasma CPU levels and lower proCPU levels than controls. This finding indicates in vivo generation of functional active CPU in patients with AMI.
26340319 CPB2 polymorphisms (reference sequences: rs1926447 and rs3742264) were related to systemic complications in bacterial meningitis. TAFI levels correlated positively with CSF complement. rs1926447 (TT) was associated with higher levels of TAFI in CSF.
26118976 TAFI deficiency results in increased brain damage in a model of thrombolysis after ischemic stroke, which was not associated with bleeding but with neuronal degeneration and MP production.
26071134 the associations between three TAFI variants -438G/A, 505G/A and 1040C/T and the risk of venous thrombosis; there was a significant association between 505G/A and the risk of disease (Meta-Analysis)
26062599 Pro-inflammatory cytokines or lipopolysaccharide decreased TAFI protein levels via binding of tristetraprolin to the CPB2 3'-UTR, which mediates CPB2 mRNA destabilisation. HuR can bind the CBP2 3'UTR. This is reduced by pro-inflammatory mediators.
25773535 Generated stable deletion mutant of TAFI with full carboxypeptidase activity without activation.
25396763 High plasma TAFI level is associated with the increasing risk of T2DM.
25193405 Neither intact TAFI nor activation peptide of TAFI can discriminate venous thromboembolism patients from healthy controls.
25066897 Arg12 of TAFI plays an important role in thrombomodulin-mediated TAFI activation by thrombin
More...

AA Sequence

MKLCSLAVLVPIVLFCEQHVFAFQSGQVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTADLIVKKKQVHF      1 - 70
FVNASDVDNVKAHLNVSGIPCSVLLADVEDLIQQQISNDTVSPRASASYYEQYHSLNEIYSWIEFITERH     71 - 140
PDMLTKIHIGSSFEKYPLYVLKVSGKEQAAKNAIWIDCGIHAREWISPAFCLWFIGHITQFYGIIGQYTN    141 - 210
LLRLVDFYVMPVVNVDGYDYSWKKNRMWRKNRSFYANNHCIGTDLNRNFASKHWCEEGASSSSCSETYCG    211 - 280
LYPESEPEVKAVASFLRRNINQIKAYISMHSYSQHIVFPYSYTRSKSKDHEELSLVASEAVRAIEKISKN    281 - 350
TRYTHGHGSETLYLAPGGGDDWIYDLGIKYSFTIELRDTGTYGFLLPERYIKPTCREAFAAVSKIAWHVI    351 - 420
RNV                                                                       421 - 423
//

Text Mined References (195)

PMID Year Title
26341360 2015 Selective modulation of thrombin-activatable fibrinolysis inhibitor (TAFI) activation by thrombin or the thrombin-thrombomodulin complex using TAFI-derived peptides.
26340515 2015 Plasma levels of carboxypeptidase U (CPU, CPB2 or TAFIa) are elevated in patients with acute myocardial infarction.
26340319 2015 Thrombin-activatable fibrinolysis inhibitor influences disease severity in humans and mice with pneumococcal meningitis.
26118976 2015 Lack of TAFI increases brain damage and microparticle generation after thrombolytic therapy in ischemic stroke.
26071134 2015 Impact of genetic polymorphisms in thrombin activatable fibrinolysis inhibitor (TAFI) on venous thrombosis disease: A meta-analysis.
26062599 2015 Pro-inflammatory cytokines reduce human TAFI expression via tristetraprolin-mediated mRNA destabilisation and decreased binding of HuR.
25773535 2015 Generation of a stable thrombin-activatable fibrinolysis inhibitor deletion mutant exerting full carboxypeptidase activity without activation.
25396763 2015 Effect of single nucleotide polymorphism in thrombin-activatable fibrinolysis inhibitor on the risk of diabetic macrovascular disease.
25193405 2014 Active PAI-1 as marker for venous thromboembolism: case-control study using a comprehensive panel of PAI-1 and TAFI assays.
25066897 2014 A role for arginine-12 in thrombin-thrombomodulin-mediated activation of thrombin-activatable fibrinolysis inhibitor.
More...