Property Summary

Ligand Count 133
NCBI Gene PubMed Count 202
PubMed Score 658.98
PubTator Score 514.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
lung adenocarcinoma -2.400 1.3e-05
lung cancer -3.700 1.1e-04
lung carcinoma -1.500 3.0e-03
non-small cell lung cancer -4.878 2.1e-34
ovarian cancer 1.200 1.2e-08
pancreatic ductal adenocarcinoma liver m... -3.384 2.2e-02
psoriasis -1.500 2.3e-06

 GWAS Trait (1)

Gene RIF (198)

AA Sequence

MKLCSLAVLVPIVLFCEQHVFAFQSGQVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTADLIVKKKQVHF      1 - 70
FVNASDVDNVKAHLNVSGIPCSVLLADVEDLIQQQISNDTVSPRASASYYEQYHSLNEIYSWIEFITERH     71 - 140
PDMLTKIHIGSSFEKYPLYVLKVSGKEQAAKNAIWIDCGIHAREWISPAFCLWFIGHITQFYGIIGQYTN    141 - 210
LLRLVDFYVMPVVNVDGYDYSWKKNRMWRKNRSFYANNHCIGTDLNRNFASKHWCEEGASSSSCSETYCG    211 - 280
LYPESEPEVKAVASFLRRNINQIKAYISMHSYSQHIVFPYSYTRSKSKDHEELSLVASEAVRAIEKISKN    281 - 350
TRYTHGHGSETLYLAPGGGDDWIYDLGIKYSFTIELRDTGTYGFLLPERYIKPTCREAFAAVSKIAWHVI    351 - 420
RNV                                                                       421 - 423
//

Text Mined References (207)

PMID Year Title