Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 1.6e-30

Synonym

Accession Q96IX9
Symbols ANKRD26L1
ANKRD36BL1

 Compartment GO Term (0)

AA Sequence

MGTRTLQFEISDSHEKEEDLLHKNHLMQDEIARLRLEIHTIKNQILEKKYLKDIEIIKRKHEDLQKALKQ      1 - 70
NGEKSTKTIAHYSGQLTALTDENTMLRSKLEKEKQSRQRLTKWNHTIVD                          71 - 119
//

Text Mined References (6)

PMID Year Title