Property Summary

NCBI Gene PubMed Count 15
PubMed Score 15.19
PubTator Score 11.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Pre-Eclampsia 68 3.32 1.7

Expression

Synonym

Accession Q96IX5 B2R4N2 D3DR92
Symbols DAPIT
USMG5
HCVFTP2
bA792D24.4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSKKTPAVKAT                  1 - 58
//

Text Mined References (18)

PMID Year Title