Property Summary

NCBI Gene PubMed Count 6
PubMed Score 41.91
PubTator Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.800 3.4e-02
Astrocytoma, Pilocytic 1.100 1.1e-03
group 4 medulloblastoma 2.300 8.0e-08
oligodendroglioma 2.500 7.5e-03
psoriasis 3.700 3.4e-15

AA Sequence

MAKWLRDYLSFGGRRPPPQPPTPDYTESDILRAYRAQKNLDFEDPYEDAESRLEPDPAGPGDSKNPGDAK      1 - 70
YGSPKHRLIKVEAADMARAKALLGGPGEELEADTEYLDPFDAQPHPAPPDDGYMEPYDAQWVMSELPGRG     71 - 140
VQLYDTPYEEQDPETADGPPSGQKPRQSRMPQEDERPADEYDQPWEWKKDHISRAFAVQFDSPEWERTPG    141 - 210
SAKELRRPPPRSPQPAERVDPALPLEKQPWFHGPLNRADAESLLSLCKEGSYLVRLSETNPQDCSLSLRS    211 - 280
SQGFLHLKFARTRENQVVLGQHSGPFPSVPELVLHYSSRPLPVQGAEHLALLYPVVTQTP              281 - 340
//

Text Mined References (6)

PMID Year Title