Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.27
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Atopic dermatitis -1.100 6.5e-04
Breast cancer -2.100 2.8e-02
breast carcinoma -2.000 4.8e-06
colon cancer -2.000 5.7e-04
ductal carcinoma in situ -2.000 1.2e-04
group 3 medulloblastoma -2.500 2.2e-05
invasive ductal carcinoma -1.166 1.3e-03
lung adenocarcinoma -1.500 2.8e-12
lung cancer -1.300 1.6e-02
malignant mesothelioma -3.700 5.9e-08
medulloblastoma, large-cell -2.000 8.5e-06
mucosa-associated lymphoid tissue lympho... 1.630 1.3e-02
non diabetic and post-ischemic heart fai... 1.600 8.9e-04
non-small cell lung cancer -2.177 1.6e-18
osteosarcoma -2.481 1.0e-03
ovarian cancer -1.700 7.8e-13
pancreatic cancer 1.700 2.1e-04
pancreatic carcinoma 1.700 2.1e-04
pancreatic ductal adenocarcinoma liver m... -1.068 1.9e-02
psoriasis -1.100 8.0e-06
type II diabetes mellitus and post-ische... 1.400 1.5e-02

AA Sequence

MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFWQAQWERLLTT      1 - 70
FEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKNEPVDPVKLRQSIRTVLFNQC     71 - 140
MISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTLIEEVLFYYSHRLLHHPTFYKKIHKKHHEWT    141 - 210
APIGVISLYAHPIEHAVSNMLPVIVGPLVMGSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHH    211 - 280
LKFNQCYGVLGVLDHLHGTDTMFKQTKAYERHVLLLGFTPLSESIPDSPKRME                     281 - 333
//

Text Mined References (6)

PMID Year Title