Property Summary

NCBI Gene PubMed Count 19
PubMed Score 77.41
PubTator Score 139.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
CONGENITAL DISORDER OF DEGLYCOSYLATION 1 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.7e-07
osteosarcoma 7950 5.0e-04
dermatomyositis 966 5.1e-03
lung cancer 4740 8.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Osteoporosis 363 0.0 1.6
Disease Target Count
NGLY1-deficiency 4

Expression

  Differential Expression (4)

Disease log2 FC p
dermatomyositis 1.100 5.1e-03
lung cancer 1.100 8.2e-03
osteosarcoma -1.226 5.0e-04
ovarian cancer -1.700 1.7e-07

Gene RIF (12)

AA Sequence

MAAAALGSSSGSASPAVAELCQNTPETFLEASKLLLTYADNILRNPNDEKYRSIRIGNTAFSTRLLPVRG      1 - 70
AVECLFEMGFEEGETHLIFPKKASVEQLQKIRDLIAIERSSRLDGSNKSHKVKSSQQPAASTQLPTTPSS     71 - 140
NPSGLNQHTRNRQGQSSDPPSASTVAADSAILEVLQSNIQHVLVYENPALQEKALACIPVQELKRKSQEK    141 - 210
LSRARKLDKGINISDEDFLLLELLHWFKEEFFHWVNNVLCSKCGGQTRSRDRSLLPSDDELKWGAKEVED    211 - 280
HYCDACQFSNRFPRYNNPEKLLETRCGRCGEWANCFTLCCRAVGFEARYVWDYTDHVWTEVYSPSQQRWL    281 - 350
HCDACEDVCDKPLLYEIGWGKKLSYVIAFSKDEVVDVTWRYSCKHEEVIARRTKVKEALLRDTINGLNKQ    351 - 420
RQLFLSENRRKELLQRIIVELVEFISPKTPKPGELGGRISGSVAWRVARGEMGLQRKETLFIPCENEKIS    421 - 490
KQLHLCYNIVKDRYVRVSNNNQTISGWENGVWKMESIFRKVETDWHMVYLARKEGSSFAYISWKFECGSV    491 - 560
GLKVDSISIRTSSQTFQTGTVEWKLRSDTAQVELTGDNSLHSYADFSGATEVILEAELSRGDGDVAWQHT    561 - 630
QLFRQSLNDHEENCLEIIIKFSDL                                                  631 - 654
//

Text Mined References (23)

PMID Year Title