Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.40
PubTator Score 11.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.200 2.0e-03
Astrocytoma, Pilocytic 1.400 4.5e-07
atypical teratoid / rhabdoid tumor 1.600 3.7e-06
glioblastoma 1.500 2.2e-04
inflammatory breast cancer -1.300 2.4e-04
invasive ductal carcinoma -1.500 3.5e-03
medulloblastoma, large-cell 2.200 4.6e-05
osteosarcoma -1.411 3.2e-03
pancreatic ductal adenocarcinoma liver m... -1.035 1.2e-03

AA Sequence

MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLP      1 - 70
GLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTD     71 - 140
KINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ    141 - 210
//

Text Mined References (17)

PMID Year Title