Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.18
PubTator Score 1.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
25263389 results suggest that Zbed3 may contribute to lung cancer cell invasion through regulating beta-catenin and p120ctn-1 and may be a promissing cancer marker in non-small cell lung cancer
24283382 results suggest that the Zbed3 protein may be a cytokine associated with insulin resistance in humans that is influenced by glucose and insulin levels.
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19141611 Zbed3 is a novel Axin-binding protein that is involved in Wnt/beta-catenin signaling modulation.

AA Sequence

MRSGEPACTMDQARGLDDAAARGGQCPGLGPAPTPTPPGRLGAPYSEAWGYFHLAPGRPGHPSGHWATCR      1 - 70
LCGEQVGRGPGFHAGTSALWRHLRSAHRRELESSGAGSSPPAAPCPPPPGPAAAPEGDWARLLEQMGALA     71 - 140
VRGSRRERELERRELAVEQGERALERRRRALQEEERAAAQARRELQAEREALQARLRDVSRREGALGWAP    141 - 210
AAPPPLKDDPEGDRDGCVITKVLL                                                  211 - 234
//

Text Mined References (13)

PMID Year Title
25263389 2015 Zbed3 contributes to malignant phenotype of lung cancer via regulating ?-catenin and P120-catenin 1.
24283382 2014 Zinc-finger BED domain-containing 3 (Zbed3) is a novel secreted protein associated with insulin resistance in humans.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23533661 2013 ZBED evolution: repeated utilization of DNA transposons as regulators of diverse host functions.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20581827 2010 Twelve type 2 diabetes susceptibility loci identified through large-scale association analysis.
19141611 2009 Identification of zinc-finger BED domain-containing 3 (Zbed3) as a novel Axin-interacting protein that activates Wnt/beta-catenin signaling.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...