Property Summary

NCBI Gene PubMed Count 4
PubMed Score 12.79
PubTator Score 6.74

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
25789692 A frameshift heterozygous mutation in RAX2 inherited in an autosomal dominant fashion was associated with mixed cone and rod dysfunction.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVR      1 - 70
VQVWFQNRRAKWRRQERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGP     71 - 140
GLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRAWPPA                              141 - 184
//

Text Mined References (6)

PMID Year Title
25789692 2015 Autosomal Dominant Retinal Dystrophy With Electronegative Waveform Associated With a Novel RAX2 Mutation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
15028672 2004 QRX, a novel homeobox gene, modulates photoreceptor gene expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.