Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.51
PubTator Score 4.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.3e-44

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 1.3e-44

Gene RIF (1)

AA Sequence

MAAPALRLCHIAFHVPAGQPLARNLQRLFGFQPLASREVDGWRQLALRSGDAVFLVNEGAGSGEPLYGLD      1 - 70
PRHAVPSATNLCFDVADAGAATRELAALGCSVPVPPVRVRDAQGAATYAVVSSPAGILSLTLLERAGYRG     71 - 140
PFLPGFRPVSSAPGPGWVSRVDHLTLACTPGSSPTLLRWFHDCLGFCHLPLSPGEDPELGLEMTAGFGLG    141 - 210
GLRLTALQAQPGSIVPTLVLAESLPGATTRQDQVEQFLARHKGPGLQHVGLYTPNIVEATEGVATAGGQF    211 - 280
LAPPGAYYQQPGKERQIRAAGHEPHLLARQGILLDGDKGKFLLQVFTKSLFTEDTFFLELIQRQGATGFG    281 - 350
QGNIRALWQSVQEQSARSQEA                                                     351 - 371
//

Text Mined References (6)

PMID Year Title