Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.27

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MEEKPSGPIPDMLATAEPSSSETDKEVLSPAVPAAAPSSSMSEEPGPEQAATPPVWERGGAGGMQQGSSP      1 - 70
APDSCQPGPGPSPGLTSIVSGTSEDLRPPRRRPPPGKQIPCSSPGCCLSFPSVRDLAQHLRTHCPPTQSL     71 - 140
EGKLFRCSALSCTETFPSMQELVAHSKLHYKPNRYFKCENCLLRFRTHRSLFKHLHVCAEHAQSPAPPPP    141 - 210
PALDREPPAPERPPEVDPASAPGLPFPLLEPFTTPAPAPTGPFLPYLNPAPFGLSPPRLRPFLAAAPGPP    211 - 280
ASSAAVWKKSQGAGSSPRRPQGGSDAPSGACR                                          281 - 312
//

Text Mined References (9)

PMID Year Title