Property Summary

NCBI Gene PubMed Count 26
PubMed Score 12.00
PubTator Score 8.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
acute myeloid leukemia 1.300 3.0e-03
acute quadriplegic myopathy 1.094 7.3e-04
adult high grade glioma 1.500 7.3e-03
astrocytoma 1.300 2.8e-11
Astrocytoma, Pilocytic 2.800 1.5e-08
atypical teratoid / rhabdoid tumor 1.200 2.7e-02
Barrett's esophagus 1.700 2.0e-02
colon cancer -1.200 9.4e-04
esophageal adenocarcinoma 1.700 1.8e-02
facioscapulohumeral dystrophy -1.500 1.7e-03
glioblastoma 1.800 2.3e-06
group 4 medulloblastoma -1.400 7.7e-03
intraductal papillary-mucinous adenoma (... 2.200 3.1e-04
intraductal papillary-mucinous carcinoma... 1.800 4.8e-03
invasive ductal carcinoma -1.300 5.3e-03
juvenile dermatomyositis 1.156 7.9e-13
lung cancer -1.900 1.2e-02
malignant mesothelioma -1.300 2.9e-05
oligodendroglioma 1.300 1.4e-10
osteosarcoma -1.807 3.6e-02
ovarian cancer -2.300 7.8e-09
Pick disease 1.100 4.4e-02
posterior fossa group A ependymoma 1.100 1.3e-03
primitive neuroectodermal tumor 1.800 1.2e-02
tuberculosis 1.400 1.7e-04
Waldenstrons macroglobulinemia 1.189 4.3e-02

Gene RIF (10)

AA Sequence

MAEGEGYFAMSEDELACSPYIPLGGDFGGGDFGGGDFGGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQ      1 - 70
VQRLDGILSETIPIHGRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHVLHQDSGLGYKDL     71 - 140
DLIFCADLRGEGEFQTVKDVVLDCLLDFLPEGVNKEKITPLTLKEAYVQKMVKVCNDSDRWSLISLSNNS    141 - 210
GKNVELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSENPMTETFHPTIIGESVYGDFQEAFDHLCNKII    211 - 280
ATRNPEEIRGGGLLKYCNLLVRGFRPASDEIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDR    281 - 350
KYEYLMTLHGVVNESTVCLMGHERRQTLNLITMLAIRVLADQNVIPNVANVTCYYQPAPYVADANFSNYY    351 - 420
IAQVQPVFTCQQQTYSTWLPCN                                                    421 - 442
//

Text Mined References (26)

PMID Year Title