Property Summary

NCBI Gene PubMed Count 24
PubMed Score 9.85
PubTator Score 8.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 7.93137005647686E-13
oligodendroglioma 2849 1.35654354566273E-10
ovarian cancer 8492 9.2767611693733E-9
pilocytic astrocytoma 3086 1.21733947982052E-8
pediatric high grade glioma 2712 2.41064691472842E-5
malignant mesothelioma 3163 2.94653217810348E-5
tuberculosis and treatment for 6 months 686 5.07552041893847E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 3.08089803282467E-4
glioblastoma 5572 3.44146219450055E-4
acute quadriplegic myopathy 1157 7.34407574024165E-4
colon cancer 1475 9.37404137961702E-4
posterior fossa group A ependymoma 1511 0.00126227296006212
facioscapulohumeral dystrophy 286 0.00170546132230822
acute myeloid leukemia 785 0.00295600541817532
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00484205557364243
primitive neuroectodermal tumor 3031 0.0118579017198304
lung cancer 4473 0.0120292309697156
invasive ductal carcinoma 2950 0.0139204607753947
sonic hedgehog group medulloblastoma 1482 0.0161096556104481
esophageal adenocarcinoma 737 0.0176010007179145
Barrett's esophagus 185 0.0204780914483485
atypical teratoid / rhabdoid tumor 4369 0.0271274124026116
osteosarcoma 7933 0.0361034932487224
astrocytoma 1493 0.0378310314211016
Waldenstrons macroglobulinemia 765 0.0432626894307518
Pick disease 1893 0.0438041948815782
Disease Target Count Z-score Confidence
Breast cancer 3099 0.0 1.0

Expression

Synonym

Accession Q96IP4 A8K7U4 Q5TF86 Q8NFZ9 Q9BW32 Q9NXV5
Symbols XTP11
C6orf37

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

Gene RIF (9)

PMID Text
25884493 Genotype frequencies of cd (four and five VNTR repeats) and cc (four VNTR repeats homozygote) of the FAM46A gene were significantly decreased in the patients compared to the healthy controls in the Croatian and Norwegian subjects
25231575 Susceptibility to large-joint osteoarthritis (hip and knee) is associated with BAG6 rs3117582 SNP and the VNTR polymorphism in the second exon of the FAM46A gene on chromosome 6.
24625963 VNTR in the coding region of the FAM46A gene, FAM46A rs11040 SNP and BAG6 rs3117582 SNP are associated with susceptibility to tuberculosis
20734064 Observational study of gene-disease association. (HuGE Navigator)
17803723 Genetic analysis of FAM46A in Spanish families with autosomal recessive retinitis pigmentosa: characterization of novel VNTRs is reported.
16924696 Observational study of genotype prevalence. (HuGE Navigator)
16545789 Observational study of gene-disease association. (HuGE Navigator)
16545789 A novel VNTR polymorphism in C6orf37 exists in Chinese population and is not associated with colorectal cancer risk
12054608 a candidate of human retinal disease on chromosome 6

AA Sequence

MAEGEGYFAMSEDELACSPYIPLGGDFGGGDFGGGDFGGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQ      1 - 70
VQRLDGILSETIPIHGRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHVLHQDSGLGYKDL     71 - 140
DLIFCADLRGEGEFQTVKDVVLDCLLDFLPEGVNKEKITPLTLKEAYVQKMVKVCNDSDRWSLISLSNNS    141 - 210
GKNVELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSENPMTETFHPTIIGESVYGDFQEAFDHLCNKII    211 - 280
ATRNPEEIRGGGLLKYCNLLVRGFRPASDEIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDR    281 - 350
KYEYLMTLHGVVNESTVCLMGHERRQTLNLITMLAIRVLADQNVIPNVANVTCYYQPAPYVADANFSNYY    351 - 420
IAQVQPVFTCQQQTYSTWLPCN                                                    421 - 442
//

Text Mined References (24)

PMID Year Title
25884493 2015 Association of the FAM46A gene VNTRs and BAG6 rs3117582 SNP with non small cell lung cancer (NSCLC) in Croatian and Norwegian populations.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25231575 2015 Susceptibility to large-joint osteoarthritis (hip and knee) is associated with BAG6 rs3117582 SNP and the VNTR polymorphism in the second exon of the FAM46A gene on chromosome 6.
24625963 2014 Association of variable number of tandem repeats in the coding region of the FAM46A gene, FAM46A rs11040 SNP and BAG6 rs3117582 SNP with susceptibility to tuberculosis.
23972371 2013 Genome-wide association analysis of blood-pressure traits in African-ancestry individuals reveals common associated genes in African and non-African populations.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
22976474 2012 A meta-analysis of genome-wide association studies of breast cancer identifies two novel susceptibility loci at 6q14 and 20q11.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21810271 2011 Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels.
More...