Property Summary

NCBI Gene PubMed Count 24
Grant Count 4
R01 Count 4
Funding $215,894.25
PubMed Score 9.85
PubTator Score 8.96

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
25884493 Genotype frequencies of cd (four and five VNTR repeats) and cc (four VNTR repeats homozygote) of the FAM46A gene were significantly decreased in the patients compared to the healthy controls in the Croatian and Norwegian subjects
25231575 Susceptibility to large-joint osteoarthritis (hip and knee) is associated with BAG6 rs3117582 SNP and the VNTR polymorphism in the second exon of the FAM46A gene on chromosome 6.
24625963 VNTR in the coding region of the FAM46A gene, FAM46A rs11040 SNP and BAG6 rs3117582 SNP are associated with susceptibility to tuberculosis
20734064 Observational study of gene-disease association. (HuGE Navigator)
17803723 Genetic analysis of FAM46A in Spanish families with autosomal recessive retinitis pigmentosa: characterization of novel VNTRs is reported.
16924696 Observational study of genotype prevalence. (HuGE Navigator)
16545789 Observational study of gene-disease association. (HuGE Navigator)
16545789 A novel VNTR polymorphism in C6orf37 exists in Chinese population and is not associated with colorectal cancer risk
12054608 a candidate of human retinal disease on chromosome 6

AA Sequence

MAEGEGYFAMSEDELACSPYIPLGGDFGGGDFGGGDFGGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQ      1 - 70
VQRLDGILSETIPIHGRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHVLHQDSGLGYKDL     71 - 140
DLIFCADLRGEGEFQTVKDVVLDCLLDFLPEGVNKEKITPLTLKEAYVQKMVKVCNDSDRWSLISLSNNS    141 - 210
GKNVELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSENPMTETFHPTIIGESVYGDFQEAFDHLCNKII    211 - 280
ATRNPEEIRGGGLLKYCNLLVRGFRPASDEIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDR    281 - 350
KYEYLMTLHGVVNESTVCLMGHERRQTLNLITMLAIRVLADQNVIPNVANVTCYYQPAPYVADANFSNYY    351 - 420
IAQVQPVFTCQQQTYSTWLPCN                                                    421 - 442
//

Text Mined References (24)

PMID Year Title
25884493 2015 Association of the FAM46A gene VNTRs and BAG6 rs3117582 SNP with non small cell lung cancer (NSCLC) in Croatian and Norwegian populations.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25231575 2015 Susceptibility to large-joint osteoarthritis (hip and knee) is associated with BAG6 rs3117582 SNP and the VNTR polymorphism in the second exon of the FAM46A gene on chromosome 6.
24625963 2014 Association of variable number of tandem repeats in the coding region of the FAM46A gene, FAM46A rs11040 SNP and BAG6 rs3117582 SNP with susceptibility to tuberculosis.
23972371 2013 Genome-wide association analysis of blood-pressure traits in African-ancestry individuals reveals common associated genes in African and non-African populations.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
22976474 2012 A meta-analysis of genome-wide association studies of breast cancer identifies two novel susceptibility loci at 6q14 and 20q11.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21810271 2011 Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels.
More...