Property Summary

NCBI Gene PubMed Count 10
Grant Count 6
R01 Count 4
Funding $338,872.82
PubMed Score 34.45
PubTator Score 4.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.100 0.003

Gene RIF (3)

PMID Text
25175347 Mutations in APOPT1, encoding a mitochondrial protein, cause cavitating leukoencephalopathy with cytochrome c oxidase deficiency.
24162774 HIV-1 gp120 upregulates the expression of mitochondrial apoptogenic 1 (APOPT1, C14orf153) in human B cells
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLPCAAGARGRGAMVVLRAGKKTFLPPLCRAFACRGCQLAPERGAERRDTAPSGVSRFCPPRKSCHDWIG      1 - 70
PPDKYSNLRPVHFYIPENESPLEQKLRKLRQETQEWNQQFWANQNLTFSKEKEEFIHSRLKTKGLGLRTE     71 - 140
SGQKATLNAEEMADFYKEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN        141 - 206
//

Text Mined References (11)

PMID Year Title
25175347 2014 Mutations in APOPT1, encoding a mitochondrial protein, cause cavitating leukoencephalopathy with cytochrome c oxidase deficiency.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18977203 2008 Akt activation prevents Apop-1-induced death of cells.
16782708 2006 Apop-1, a novel protein inducing cyclophilin D-dependent but Bax/Bak-related channel-independent apoptosis.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...