Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.51
PubTator Score 5.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.629 0.000
group 3 medulloblastoma 1.500 0.001
non-small cell lung cancer 1.153 0.000
lung cancer 1.800 0.001
aldosterone-producing adenoma -1.159 0.025

Synonym

Accession Q96IK5 Q9H826 Q9H8V7 Q9H927
Symbols GCL
GCL1
BTBD13
SPATA29

Gene

Gene RIF (5)

PMID Text
23029259 Dual association of GAGE family members with GCL at the nuclear envelope inner membrane in cells, and with dsDNA in vitro, implicate GAGE proteins in chromatin regulation in germ cells and cancer cells.
12954656 Germ cell-less protein is not essential for the chromosomal events of meiosis but might be involved in later aspects of spermatogenesis.
12927808 mGCL-1 is a factor modulating MDM2-p53 axis by enhanced degradation of MDM2
12493765 GCL binds directly to emerin, and the emerin-repressor complexes might be regulated by barrier to autointegration factor
9878064 Mouse GMCL1 interacts with the DP component of the E2F transcription factor.

AA Sequence

MGSLSSRVLRQPRPALAQQAQGARAGGSARRPDTGDDAAGHGFCYCAGSHKRKRSSGSFCYCHPDSETDE      1 - 70
DEEEGDEQQRLLNTPRRKKLKSTSKYIYQTLFLNGENSDIKICALGEEWSLHKIYLCQSGYFSSMFSGSW     71 - 140
KESSMNIIELEIPDQNIDVEALQVAFGSLYRDDVLIKPSRVVAILAAACLLQLDGLIQQCGETMKETVNV    141 - 210
KTVCGYYTSAGTYGLDSVKKKCLEWLLNNLMTHQNVELFKELSINVMKQLIGSSNLFVMQVEMDIYTALK    211 - 280
KWMFLQLVPSWNGSLKQLLTETDVWFSKQRKDFEGMAFLETEQGKPFVSVFRHLRLQYIISDLASARIIE    281 - 350
QDAVVPSEWLSSVYKQQWFAMLRAEQDSEVGPQEINKEELEGNSMRCGRKLAKDGEYCWRWTGFNFGFDL    351 - 420
LVTYTNRYIIFKRNTLNQPCSGSVSLQPRRSIAFRLRLASFDSSGKLICSRTTGYQILTLEKDQEQVVMN    421 - 490
LDSRLLIFPLYICCNFLYISPEKKN                                                 491 - 515
//

Text Mined References (11)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
23029259 2012 GAGE cancer-germline antigens are recruited to the nuclear envelope by germ cell-less (GCL).
21516116 2011 Next-generation sequencing to generate interactome datasets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12954656 Reduced human germ cell-less (HGCL) expression in azoospermic men with severe germinal cell impairment.
12927808 2003 Enhanced degradation of MDM2 by a nuclear envelope component, mouse germ cell-less.
12493765 2003 Transcriptional repressor germ cell-less (GCL) and barrier to autointegration factor (BAF) compete for binding to emerin in vitro.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11591818 2001 Nuclear membrane protein LAP2beta mediates transcriptional repression alone and together with its binding partner GCL (germ-cell-less).
More...