Property Summary

NCBI Gene PubMed Count 9
PubMed Score 12.45
PubTator Score 6.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.9e-05
group 3 medulloblastoma 4104 4.6e-04
spina bifida 1074 4.2e-02
Disease Target Count Z-score Confidence
Myoma 12 3.206 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.300 4.6e-04
ovarian cancer -1.400 1.9e-05
spina bifida -1.099 4.2e-02

Gene RIF (4)

AA Sequence

MADGGGGGGTGAVGGGGTSQASAGAATGATGASGGGGPINPASLPPGDPQLIALIVEQLKSRGLFDSFRR      1 - 70
DCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPTMNKNQLRNGLRQSVVQSGMLEAGVDRIISQVVDPK     71 - 140
LNHIFRPQIERAIHEFLAAQKKAAVPAPPPEPEGQDPPAPSQDTS                             141 - 185
//

Text Mined References (11)

PMID Year Title