Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 5.9e-08
group 3 medulloblastoma 4104 4.4e-05
Breast cancer 3578 1.7e-04

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer -1.300 1.7e-04
group 3 medulloblastoma 1.300 4.4e-05
osteosarcoma -2.865 5.9e-08

Synonym

Accession Q96IK0 B2R9N6
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MASKIGSRRWMLQLIMQLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMGAAVLCASFMS      1 - 70
FGVKRRWFALGAALQLAISTYAAYIGGYVHYGDWLKVRMYSRTVAIIGGFLVLASGAGELYRRKPRSRSL     71 - 140
QSTGQVFLGIYLICVAYSLQHSKEDRLAYLNHLPGGELMIQLFFVLYGILALAFLSGYYVTLAAQILAVL    141 - 210
LPPVMLLIDGNVAYWHNTRRVEFWNQMKLLGESVGIFGTAVILATDG                           211 - 257
//

Text Mined References (7)

PMID Year Title