Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.05710394532364E-12
posterior fossa group A ependymoma 1511 8.49712211090262E-10
medulloblastoma, large-cell 6234 1.47394167882933E-5
atypical teratoid / rhabdoid tumor 4369 2.48642406287395E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00121323427012954
invasive ductal carcinoma 2950 0.00145404296430165
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00189883551687706
astrocytic glioma 2241 0.00275742474495747
oligodendroglioma 2849 0.00284202230622205
psoriasis 6685 0.00369490474446159
osteosarcoma 7933 0.0062789997107691
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00882243566426425
group 4 medulloblastoma 1875 0.0198858625824655
tuberculosis and treatment for 6 months 686 0.0221896054111339

Expression

Synonym

Accession Q96II8 B4E0T7 Q96FP9 Q9NT52
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG

AA Sequence

MAAAGLVAVAAAAEYSGTVASGGNLPGVHCGPSSGAGPGFGPGSWSRSLDRALEEAAVTGVLSLSGRKLR      1 - 70
EFPRGAANHDLTDTTRADLSRNRLSEIPIEACHFVSLENLNLYQNCIRYIPEAILNLQALTFLNISRNQL     71 - 140
STLPVHLCNLPLKVLIASNNKLVSLPEEIGHLRHLMELDVSCNEIQTIPSQIGNLEALRDLNVRRNHLVH    141 - 210
LPEELAELPLIRLDFSCNKITTIPVCYRNLRHLQTITLDNNPLQSPPAQICIKGKVHIFKYLNIQACKIA    211 - 280
PDLPDYDRRPLGFGSCHEELYSSRPYGALDSGFNSVDSGDKRWSGNEPTDEFSDLPLRVAEITKEQRLRR    281 - 350
ESQYQENRGSLVVTNGGVEHDLDQIDYIDSCTAEEEEAEVRQPKGPDPDSLSSQFMAYIEQRRISHEGSP    351 - 420
VKPVAIREFQKTEDMRRYLHQNRVPAEPSSLLSLSASHNQLSHTDLELHQRREQLVERTRREAQLAALQY    421 - 490
EEEKIRTKQIQRDAVLDFVKQKASQSPQKQHPLLDGVDGECPFPSRRSQHTDDSALCMSLSGLNQVGCAA    491 - 560
TLPHSSAFTPLKSDDRPNALLSSPATETVHHSPAYSFPAAIQRNQPQRPESFLFRAGVRAETNKGHASPL    561 - 630
PPSAAPTTDSTDSITGQNSRQREEELELIDQLRKHIEYRLKVSLPCDLGAALTDGVVLCHLANHVRPRSV    631 - 700
PSIHVPSPAVPKLTMAKCRRNVENFLEACRKIGVPQEQLCLPLHILEEKGLSQVAVTVQALLELAPPKQQ    701 - 770
QHQLSAV                                                                   771 - 777
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20805893 2010 LRCH proteins: a novel family of cytoskeletal regulators.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
More...