Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.24
PubTator Score 0.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.100 3.8e-05
aldosterone-producing adenoma -1.186 5.7e-03
atypical teratoid / rhabdoid tumor -1.100 1.4e-03
Breast cancer 1.500 4.9e-07
cystic fibrosis and chronic rhinosinusit... 1.077 3.5e-02
glioblastoma -1.200 8.3e-04
group 3 medulloblastoma 1.200 3.0e-03
non primary Sjogren syndrome sicca -1.100 2.0e-02
osteosarcoma -1.609 5.0e-06
ovarian cancer -1.100 4.8e-10
Pick disease 1.600 2.9e-04
primitive neuroectodermal tumor 1.100 8.3e-03
progressive supranuclear palsy 1.400 3.5e-02
spina bifida -1.351 4.6e-02
subependymal giant cell astrocytoma -1.151 2.3e-02

Gene RIF (3)

AA Sequence

MRRDVNGVTKSRFEMFSNSDEAVINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDL      1 - 70
FDFQRDIEGRVVENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDATCTSLSK     71 - 140
FCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLED    141 - 210
EALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEV    211 - 280
ARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGA    281 - 350
CAHDQLEVIELDNCPLITDASLEHLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPP    351 - 420
SVGGSRQRFCRCCIIL                                                          421 - 436
//

Text Mined References (16)

PMID Year Title