Property Summary

NCBI Gene PubMed Count 30
PubMed Score 12.90
PubTator Score 21.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 2.94650635801435E-21
atypical teratoid / rhabdoid tumor 4369 9.76926965506536E-12
pediatric high grade glioma 2712 4.11798890491763E-9
glioblastoma 5572 2.01479506444393E-6
pilocytic astrocytoma 3086 3.88217045100592E-5
sonic hedgehog group medulloblastoma 1482 8.13736866826557E-5
primitive neuroectodermal tumor 3031 9.83691578777219E-5
ovarian cancer 8492 2.89480971735674E-4
nasopharyngeal carcinoma 1056 0.00158066751666054
osteosarcoma 7933 0.00367662607172668
Polycystic Ovary Syndrome 335 0.00424971217535458
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0066389708340128
interstitial cystitis 2299 0.0121523827234818
spina bifida 1064 0.0360372103609784
active ulcerative colitis 477 0.0389326923659638
adrenocortical carcinoma 1427 0.0451757839142966
Breast cancer 3099 0.0454514202621798

Expression

Synonym

Accession Q96IF1 A8MX18 D3DS37
Symbols JUB

Gene

  Ortholog (7)

 MGI Term (1)

Gene RIF (13)

PMID Text
26406867 The results in this study uncovered that JUB was a regulator involved in proliferation of glioma cells, and it could be used as a potential therapeutic target for glioma.
24680704 The LIM domain of Ajuba can competitively bind to the N-terminal of Aurora-A, and inhibited the interaction between N-terminal and C-terminal of Aurora A.
24673742 the LIM protein JUB serves as a tumor-promoting gene in colorectal cancer by promoting epithelial-mesenchymal transition, a critical process of metastasis.
24336325 AJUBA negatively regulates YAP activity through the LATS family, and inactivation of AJUBA is a novel key mechanism in malignant mesothelioma cell proliferation
22105346 A Rac-PAK1-Ajuba feedback loop integrates spatiotemporal signaling with actin remodeling at cell-cell contacts and stabilizes preassembled cadherin complexes.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20133701 Ajuba contains functional nuclear-receptor interacting motifs and selectively interacts with retinoic acid receptors and rexinoid receptor subtypes.
18805794 Ajuba is utilized as a corepressor selectively on Gfi1 target genes
18710370 Ajuba is a microtubule-associated protein that collaborates with Aurora B and BUBR1 at the metaphase-anaphase transition and this may be important to ensure proper chromosome segregation.
17621269 Ajuba promoted GSK-3beta-mediated phosphorylation of beta-catenin by reinforcing the association between beta-catenin and GSK-3beta.
More...

AA Sequence

MERLGEKASRLLEKFGRRKGESSRSGSDGTPGPGKGRLSGLGGPRKSGPRGATGGPGDEPLEPAREQGSL      1 - 70
DAERNQRGSFEAPRYEGSFPAGPPPTRALPLPQSLPPDFRLEPTAPALSPRSSFASSSASDASKPSSPRG     71 - 140
SLLLDGAGAGGAGGSRPCSNRTSGISMGYDQRHGSPLPAGPCLFGPPLAGAPAGYSPGGVPSAYPELHAA    141 - 210
LDRLYAQRPAGFGCQESRHSYPPALGSPGALAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDEL    211 - 280
TALLRLTVGTGGREAGARGEPSGIEPSGLEEPPGPFVPEAARARMREPEAREDYFGTCIKCNKGIYGQSN    281 - 350
ACQALDSLYHTQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLILEKILQAMGK    351 - 420
SYHPGCFRCIVCNKCLDGIPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIVRVISMDRDYH    421 - 490
FECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLNARQPPANYI                          491 - 538
//

Text Mined References (40)

PMID Year Title
26406867 2015 siRNA-mediated knockdown of JUB expression suppresses the proliferation of glioblastoma cells.
25314079 2014 Acetylation of snail modulates the cytokinome of cancer cells to enhance the recruitment of macrophages.
24680704 2014 A novel mechanism for activation of Aurora-A kinase by Ajuba.
24673742 2014 LIM protein JUB promotes epithelial-mesenchymal transition in colorectal cancer.
24336325 2015 LIM-domain protein AJUBA suppresses malignant mesothelioma cell proliferation via Hippo signaling cascade.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23704328 2013 Genome-wide association study of primary tooth eruption identifies pleiotropic loci associated with height and craniofacial distances.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22286099 2012 The LIMD1 protein bridges an association between the prolyl hydroxylases and VHL to repress HIF-1 activity.
22105346 2011 Ajuba is required for Rac activation and maintenance of E-cadherin adhesion.
More...