Property Summary

NCBI Gene PubMed Count 30
Grant Count 10
R01 Count 10
Funding $975,434.61
PubMed Score 12.90
PubTator Score 21.58

Knowledge Summary

Patent

No data available

Expression

 MGI Term (1)

Gene RIF (13)

PMID Text
26406867 The results in this study uncovered that JUB was a regulator involved in proliferation of glioma cells, and it could be used as a potential therapeutic target for glioma.
24680704 The LIM domain of Ajuba can competitively bind to the N-terminal of Aurora-A, and inhibited the interaction between N-terminal and C-terminal of Aurora A.
24673742 the LIM protein JUB serves as a tumor-promoting gene in colorectal cancer by promoting epithelial-mesenchymal transition, a critical process of metastasis.
24336325 AJUBA negatively regulates YAP activity through the LATS family, and inactivation of AJUBA is a novel key mechanism in malignant mesothelioma cell proliferation
22105346 A Rac-PAK1-Ajuba feedback loop integrates spatiotemporal signaling with actin remodeling at cell-cell contacts and stabilizes preassembled cadherin complexes.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20133701 Ajuba contains functional nuclear-receptor interacting motifs and selectively interacts with retinoic acid receptors and rexinoid receptor subtypes.
18805794 Ajuba is utilized as a corepressor selectively on Gfi1 target genes
18710370 Ajuba is a microtubule-associated protein that collaborates with Aurora B and BUBR1 at the metaphase-anaphase transition and this may be important to ensure proper chromosome segregation.
17621269 Ajuba promoted GSK-3beta-mediated phosphorylation of beta-catenin by reinforcing the association between beta-catenin and GSK-3beta.
More...

AA Sequence

MERLGEKASRLLEKFGRRKGESSRSGSDGTPGPGKGRLSGLGGPRKSGPRGATGGPGDEPLEPAREQGSL      1 - 70
DAERNQRGSFEAPRYEGSFPAGPPPTRALPLPQSLPPDFRLEPTAPALSPRSSFASSSASDASKPSSPRG     71 - 140
SLLLDGAGAGGAGGSRPCSNRTSGISMGYDQRHGSPLPAGPCLFGPPLAGAPAGYSPGGVPSAYPELHAA    141 - 210
LDRLYAQRPAGFGCQESRHSYPPALGSPGALAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDEL    211 - 280
TALLRLTVGTGGREAGARGEPSGIEPSGLEEPPGPFVPEAARARMREPEAREDYFGTCIKCNKGIYGQSN    281 - 350
ACQALDSLYHTQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLILEKILQAMGK    351 - 420
SYHPGCFRCIVCNKCLDGIPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIVRVISMDRDYH    421 - 490
FECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLNARQPPANYI                          491 - 538
//

Text Mined References (40)

PMID Year Title
26406867 2015 siRNA-mediated knockdown of JUB expression suppresses the proliferation of glioblastoma cells.
25314079 2014 Acetylation of snail modulates the cytokinome of cancer cells to enhance the recruitment of macrophages.
24680704 2014 A novel mechanism for activation of Aurora-A kinase by Ajuba.
24673742 2014 LIM protein JUB promotes epithelial-mesenchymal transition in colorectal cancer.
24336325 2015 LIM-domain protein AJUBA suppresses malignant mesothelioma cell proliferation via Hippo signaling cascade.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23704328 2013 Genome-wide association study of primary tooth eruption identifies pleiotropic loci associated with height and craniofacial distances.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22286099 2012 The LIMD1 protein bridges an association between the prolyl hydroxylases and VHL to repress HIF-1 activity.
22105346 2011 Ajuba is required for Rac activation and maintenance of E-cadherin adhesion.
More...