Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.33

Knowledge Summary

Patent

No data available

Synonym

Gene

AA Sequence

MEPEREGTERHPRKVRESRQAPNKLVGAAEAMKAGWDLEESQPEAKKARLSTILFTDNCEVTHDQLCELL      1 - 70
KYAVLGKSNVPKPSWCQLFHQNHLNNVVVFVLQGMSQLHFYRFYLEFGCLRKAFRHKFRLPPPSSDFLAD     71 - 140
VVGLQTEQRAGDLPKTMEGPLPSNAKAAINLQDDPIIQKYGSKKVGLTRCLLTKEEMRTFHFPLQGFPDC    141 - 210
ENFLLTKCNGSIADNSPLFGLDCEMCLTSKGRELTRISLVAEGGCCVMDELVKPENKILDYLTSFSGITK    211 - 280
KILNPVTTKLKDVQRQLKALLPPDAVLVGHSLDLDLRALKMIHPYVIDTSLLYVREQGRRFKLKFLAKVI    281 - 350
LGKDIQCPDRLGHDATEDARTILELARYFLKHGPKKIAELNLEALANHQEIQAAGQEPKNTAEVLQHPNT    351 - 420
SVLECLDSVGQKLLFLTRETDAGELPSSRNCQTIKCLSNKEVLEQARVEIPLFPFSIVQFSFKAFSPVLT    421 - 490
EEMNKRMRIKWTEISTVYAGPFSKNCNLRALKRLFKSFGPVQSMTFVLETRQPHLCIQYEVLEAAQLAIE    491 - 560
SLDGILVDGICIKVQRPVTELTLDCDTLVNELEGDSENQGSIYLSGVSETFKEQLLQEPRLFLGLEAVIL    561 - 630
PKDLKSGKQKKYCFLKFKSFGSAQQALNILTGKDWKLKGRHALTPRHLHAWLRGLPPESTRLPGLRVVPP    631 - 700
PFEQEALQTLKLDHPKIAAWRWSRKIGKLYNSLCPGTLCLILLPGTKSTHGSLSGLGLMGIKEEEESAGP    701 - 770
GLCS                                                                      771 - 774
//

Text Mined References (12)

PMID Year Title
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
More...