Property Summary

NCBI Gene PubMed Count 21
PubMed Score 882.92
PubTator Score 165.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytoma 1.300 2.2e-02
Astrocytoma, Pilocytic 1.200 6.4e-05
Breast cancer 2.200 4.1e-02
colon cancer -2.100 2.7e-02
Down syndrome 1.300 3.0e-03
glioblastoma 1.100 1.5e-03
group 3 medulloblastoma -1.400 1.5e-02
lung adenocarcinoma 1.034 1.7e-05
lung cancer -1.600 6.9e-04
malignant mesothelioma -1.100 1.1e-05
mucosa-associated lymphoid tissue lympho... 1.294 2.8e-02
Multiple myeloma 2.751 2.1e-05
ovarian cancer -1.500 1.5e-03
pancreatic ductal adenocarcinoma liver m... -1.791 8.3e-03
psoriasis 1.100 2.7e-03
subependymal giant cell astrocytoma 1.615 2.9e-02
tuberculosis 1.400 1.0e-08
ulcerative colitis -1.300 2.3e-06
Waldenstrons macroglobulinemia 1.215 4.2e-02

Protein-protein Interaction (5)

Gene RIF (10)

AA Sequence

MASPVAAQAGKLLRALALRPRFLAAGSQAVQLTSRRWLNLQEYQSKKLMSDNGVRVQRFFVADTANEALE      1 - 70
AAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKV     71 - 140
MVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEGIKDSQAQRMAEN    141 - 210
LGFVGPLKSQAADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKS    211 - 280
ENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYQAFKLLT    281 - 350
ADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLED    351 - 420
AAKKAVASVAKK                                                              421 - 432
//

Text Mined References (27)

PMID Year Title