Property Summary

NCBI Gene PubMed Count 19
Grant Count 234
R01 Count 175
Funding $21,797,197.43
PubMed Score 860.63
PubTator Score 165.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.215 0.042
Multiple myeloma 2.751 0.000
malignant mesothelioma -1.100 0.000
psoriasis 1.100 0.003
glioblastoma multiforme 1.100 0.000
astrocytoma 1.300 0.022
group 4 medulloblastoma -2.200 0.000
tuberculosis 1.400 0.000
pancreatic ductal adenocarcinoma liver m... -1.791 0.008
colon cancer -2.100 0.027
lung cancer -1.800 0.000
Breast cancer 2.200 0.041
pilocytic astrocytoma 1.200 0.000
subependymal giant cell astrocytoma 1.615 0.029
lung adenocarcinoma 1.066 0.000
mucosa-associated lymphoid tissue lympho... 1.294 0.028
ulcerative colitis -1.300 0.000
ovarian cancer -1.500 0.001
Down syndrome 1.300 0.003

Synonym

Accession Q96I99 C9JVT2 O95195 Q6NUH7 Q86VX8 Q8WUQ1
Symbols G-SCS
GBETA
GTPSCS

Gene

PANTHER Protein Class (1)

Gene RIF (11)

PMID Text
25370487 The absence of SUCLA2 and SUCLG2 in human glia is in compliance with the presence of alternative pathways occurring in these cells, namely the GABA shunt and ketone body metabolism
25027320 SUCLG2 has been identified as both a determinator of CSF amyloid beta-protein (1-42) levels and as attenuator of cognitive decline in Alzheimer's disease.
22190034 HIV-1 Pol is identified to have a physical interaction with succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 Pol is identified to have a physical interaction with succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21295139 Loss of SUCLG2 is associated with mitochondrial DNA depletion and results in mitochondrial depletion syndrome.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20161066 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MASPVAAQAGKLLRALALRPRFLAAGSQAVQLTSRRWLNLQEYQSKKLMSDNGVRVQRFFVADTANEALE      1 - 70
AAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKV     71 - 140
MVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEGIKDSQAQRMAEN    141 - 210
LGFVGPLKSQAADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKS    211 - 280
ENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYQAFKLLT    281 - 350
ADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLED    351 - 420
AAKKAVASVAKK                                                              421 - 432
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25370487 2015 Localization of SUCLA2 and SUCLG2 subunits of succinyl CoA ligase within the cerebral cortex suggests the absence of matrix substrate-level phosphorylation in glial cells of the human brain.
25027320 2014 SUCLG2 identified as both a determinator of CSF A?1-42 levels and an attenuator of cognitive decline in Alzheimer's disease.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23146381 2013 A meta-analysis of genome-wide association studies for serum total IgE in diverse study populations.
22144915 2011 Genome-wide meta-analysis of five Asian cohorts identifies PDGFRA as a susceptibility locus for corneal astigmatism.
21295139 2011 The interplay between SUCLA2, SUCLG2, and mitochondrial DNA depletion.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
More...