Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.28
PubTator Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 9.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Glaucoma 239 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 9.9e-04

Gene RIF (1)

AA Sequence

MAVPGEAEEEATVYLVVSGIPSVLRSAHLRSYFSQFREERGGGFLCFHYRHRPERAPPQAAPNSALIPTD      1 - 70
PAAEGQLLSQTSATDVRPLSTRDSTPIQTRTCCCVISVRGLAQAQRLIRMYSGRRWLDSHGTWLPGRCLI     71 - 140
RRLRLPTEASGLGSFPFKTRKELQSWKAENEAFTLADLKQLPELNPPVLMPRGNVGTPLRVFLELIRACR    141 - 210
LPPRIITQLQLQFPKTGSSRRYGNVPFEYEDSETVEQEELVYTAEGEEIPQGTYLADIPASPCGEPEEEV    211 - 280
GKEEEEESHSDEDDDRGEEWERHEALHEDVTGQERTTEQLFEEEIELKWEKGGSGLVFYTDAQFWQEEEG    281 - 350
DFDEQTADDWDVDMSVYYDRDGGDKDARDSVQMRLEQRLRDGQEDGSVIERQVGTFERHTKGIGRKVMER    351 - 420
QGWAEGQGLGCRCSGVPEALDSDGQHPRCKRGLGYHGEKLQPFGQLKRPRRNGLGLISTIYDEPLPQDQT    421 - 490
ESLLRRQPPTSMKFRTDMAFVRGSSCASDSPSLPD                                       491 - 525
//

Text Mined References (8)

PMID Year Title