Property Summary

NCBI Gene PubMed Count 14
PubMed Score 38.21
PubTator Score 8.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 24 1 0.0 0.0
Disease Target Count
Leigh disease 100
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 0.0 4.0
Disease Target Count Z-score Confidence
Filariasis 21 4.954 2.5
Myositis 30 3.477 1.7
Alpers syndrome 9 3.296 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -1.100 7.1e-03
atypical teratoid / rhabdoid tumor 1.400 1.5e-04
group 3 medulloblastoma 1.600 4.1e-05
lung cancer 1.900 1.1e-05
medulloblastoma, large-cell 1.500 2.7e-06

Gene RIF (7)

AA Sequence

MLGVRCLLRSVRFCSSAPFPKHKPSAKLSVRDALGAQNASGERIKIQGWIRSVRSQKEVLFLHVNDGSSL      1 - 70
ESLQVVADSGLDSRELNFGSSVEVQGQLIKSPSKRQNVELKAEKIKVIGNCDAKDFPIKYKERHPLEYLR     71 - 140
QYPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHTPIITSNDSEGAGELFQLEPSGKLKVPEENF    141 - 210
FNVPAFLTVSGQLHLEVMSGAFTQVFTFGPTFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELF    211 - 280
KATTMMVLSKCPEDVELCHKFIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTE    281 - 350
HEKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLA    351 - 420
RSGLTEVYQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLL                 421 - 477
//

Text Mined References (19)

PMID Year Title