Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.27
PubTator Score 0.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Williams Syndrome 10
Disease Target Count P-value
osteosarcoma 7933 1.60228841965478E-7
tuberculosis and treatment for 6 months 686 1.6435806963434E-5
psoriasis 6685 1.47684724588405E-4
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 45 4.49 2.2

AA Sequence

MALVALVAGARLGRRLSGPGLGRGHWTAARRSRSRREAAEAEAEVPVVQYVGERAARADRVFVWGFSFSG      1 - 70
ALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQKISSAACGYGFTLLSSKTADVTKVWGMGLNKDS     71 - 140
QLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQCGRKV    141 - 210
VENEIYSESHRVHRMQDFDGQVVQVACGQDHSLFLTDKGEVYSCGWGADGQTGLGHYNITSSPTKLGGDL    211 - 280
AGVNVIQVATYGDCCLAVSADGGLFGWGNSEYLQLASVTDSTQVNVPRCLHFSGVGKVRQAACGGTGCAV    281 - 350
LNGEGHVFVWGYGILGKGPNLVESAVPEMIPPTLFGLTEFNPEIQVSRIRCGLSHFAALTNKGELFVWGK    351 - 420
NIRGCLGIGRLEDQYFPWRVTMPGEPVDVACGVDHMVTLAKSFI                              421 - 464
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12073013 2002 Identification of additional transcripts in the Williams-Beuren syndrome critical region.
More...