Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.85
PubTator Score 0.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.6e-07
psoriasis 6694 1.5e-04
tuberculosis and treatment for 3 months 179 1.6e-03
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 50 5.302 2.7

 GO Function (1)

 GO Component (1)

Gene RIF (1)

AA Sequence

MALVALVAGARLGRRLSGPGLGRGHWTAARRSRSRREAAEAEAEVPVVQYVGERAARADRVFVWGFSFSG      1 - 70
ALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQKISSAACGYGFTLLSSKTADVTKVWGMGLNKDS     71 - 140
QLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQCGRKV    141 - 210
VENEIYSESHRVHRMQDFDGQVVQVACGQDHSLFLTDKGEVYSCGWGADGQTGLGHYNITSSPTKLGGDL    211 - 280
AGVNVIQVATYGDCCLAVSADGGLFGWGNSEYLQLASVTDSTQVNVPRCLHFSGVGKVRQAACGGTGCAV    281 - 350
LNGEGHVFVWGYGILGKGPNLVESAVPEMIPPTLFGLTEFNPEIQVSRIRCGLSHFAALTNKGELFVWGK    351 - 420
NIRGCLGIGRLEDQYFPWRVTMPGEPVDVACGVDHMVTLAKSFI                              421 - 464
//

Text Mined References (13)

PMID Year Title