Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.10
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma -1.200 0.000
non primary Sjogren syndrome sicca 1.100 0.026
lung carcinoma 1.600 0.000

AA Sequence

MVNLGLSRVDDAVAAKHPGLGEYAACQSHAFMKGVFTFVTGTGMAFGLQMFIQRKFPYPLQWSLLVAVVA      1 - 70
GSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS                                     71 - 108
//

Text Mined References (8)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22609626 2012 Facile backbone structure determination of human membrane proteins by NMR spectroscopy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.