Property Summary

NCBI Gene PubMed Count 9
Grant Count 14
R01 Count 12
Funding $514,812.33
PubMed Score 7.70
PubTator Score 3.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.100 0.021
ependymoma -1.200 0.025
pancreatic ductal adenocarcinoma liver m... -1.776 0.008
diabetes mellitus -1.100 0.009

Gene RIF (2)

PMID Text
25604084 COX14 was undetectable in COA3 subject fibroblasts, and that COA3 was undetectable in fibroblasts from a COX14 subject, demonstrating the interdependence of these two COX assembly factors
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPTGKQLADIGYKTFSTSMMLLTVYGGYLCSVRVYHYFQWRRAQRQAAEEQKTSGIM                   1 - 57
//

Text Mined References (12)

PMID Year Title
27693358 2016 Mitochondrial Protein Synthesis Adapts to Influx of Nuclear-Encoded Protein.
25604084 2015 Mutations in COA3 cause isolated complex IV deficiency associated with neuropathy, exercise intolerance, obesity, and short stature.
23260140 2012 MITRAC links mitochondrial protein translocation to respiratory-chain assembly and translational regulation.
22356826 2012 Iterative orthology prediction uncovers new mitochondrial proteins and identifies C12orf62 as the human ortholog of COX14, a protein involved in the assembly of cytochrome c oxidase.
22243966 2012 Mutations in C12orf62, a factor that couples COX I synthesis with cytochrome c oxidase assembly, cause fatal neonatal lactic acidosis.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...