Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.17
PubTator Score 2.29

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 4.05706709141566E-11
lung adenocarcinoma 2714 5.8867468860804E-7
Breast cancer 3099 3.14617971792799E-5
Duchenne muscular dystrophy 602 1.52621814463884E-4
interstitial cystitis 2299 0.00242142367110315
Becker muscular dystrophy 187 0.0389217849381492


  Differential Expression (6)

Disease log2 FC p
ependymoma 1.500 0.000
Duchenne muscular dystrophy -1.078 0.000
Becker muscular dystrophy -1.038 0.039
interstitial cystitis -1.300 0.002
lung adenocarcinoma 1.100 0.000
Breast cancer 1.200 0.000


Accession Q96I34 D3DWM5
Symbols MYPT3


  Ortholog (8)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG

Pathway (1)

Gene RIF (2)

21509594 PPP1R16A gene expression is decreased in follicular variant of papillary thyroid carcinoma.
16920702 analysis of a novel mechanism for the phosphorylation of MYPT3 by PKA and activation of the catalytic activity through direct interaction of a central region of MYPT3 with its N-terminal region

AA Sequence

VTPQPDCGFRAGGDPPLLKLTAPAVEAPVERRPCCLLM                                    491 - 528

Text Mined References (18)

PMID Year Title
26401656 2015 Integration of Genome-Wide SNP Data and Gene-Expression Profiles Reveals Six Novel Loci and Regulatory Mechanisms for Amino Acids and Acylcarnitines in Whole Blood.
25416956 2014 A proteome-scale map of the human interactome network.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21712390 2011 Ornithine decarboxylase antizyme Oaz3 modulates protein phosphatase activity.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
19060904 2009 An empirical framework for binary interactome mapping.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16920702 2006 Phosphorylation of myosin phosphatase targeting subunit 3 (MYPT3) and regulation of protein phosphatase 1 by protein kinase A.