Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.17
PubTator Score 2.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (6)

Disease log2 FC p
Becker muscular dystrophy -1.038 3.9e-02
Breast cancer 1.200 3.1e-05
Duchenne muscular dystrophy -1.078 1.5e-04
ependymoma 1.500 4.1e-11
interstitial cystitis -1.300 2.4e-03
lung adenocarcinoma 1.100 5.9e-07

Gene RIF (2)

AA Sequence

MAEHLELLAEMPMVGRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLKQVLFP      1 - 70
PSVVLLEAAARNDLEEVRQFLGSGVSPDLANEDGLTALHQCCIDDFREMVQQLLEAGANINACDSECWTP     71 - 140
LHAAATCGHLHLVELLIASGANLLAVNTDGNMPYDLCDDEQTLDCLETAMADRGITQDSIEAARAVPELR    141 - 210
MLDDIRSRLQAGADLHAPLDHGATLLHVAAANGFSEAAALLLEHRASLSAKDQDGWEPLHAAAYWGQVPL    211 - 280
VELLVAHGADLNAKSLMDETPLDVCGDEEVRAKLLELKHKHDALLRAQSRQRSLLRRRTSSAGSRGKVVR    281 - 350
RVSLTQRTDLYRKQHAQEAIVWQQPPPTSPEPPEDNDDRQTGAELRPPPPEEDNPEVVRPHNGRVGGSPV    351 - 420
RHLYSKRLDRSVSYQLSPLDSTTPHTLVHDKAHHTLADLKRQRAAAKLQRPPPEGPESPETAEPGLPGDT    421 - 490
VTPQPDCGFRAGGDPPLLKLTAPAVEAPVERRPCCLLM                                    491 - 528
//

Text Mined References (19)

PMID Year Title