Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.17
PubTator Score 2.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.500 0.000
Duchenne muscular dystrophy -1.078 0.000
Becker muscular dystrophy -1.038 0.039
interstitial cystitis -1.300 0.002
lung adenocarcinoma 1.100 0.000
Breast cancer 1.200 0.000

Gene RIF (2)

PMID Text
21509594 PPP1R16A gene expression is decreased in follicular variant of papillary thyroid carcinoma.
16920702 analysis of a novel mechanism for the phosphorylation of MYPT3 by PKA and activation of the catalytic activity through direct interaction of a central region of MYPT3 with its N-terminal region

AA Sequence

MAEHLELLAEMPMVGRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLKQVLFP      1 - 70
PSVVLLEAAARNDLEEVRQFLGSGVSPDLANEDGLTALHQCCIDDFREMVQQLLEAGANINACDSECWTP     71 - 140
LHAAATCGHLHLVELLIASGANLLAVNTDGNMPYDLCDDEQTLDCLETAMADRGITQDSIEAARAVPELR    141 - 210
MLDDIRSRLQAGADLHAPLDHGATLLHVAAANGFSEAAALLLEHRASLSAKDQDGWEPLHAAAYWGQVPL    211 - 280
VELLVAHGADLNAKSLMDETPLDVCGDEEVRAKLLELKHKHDALLRAQSRQRSLLRRRTSSAGSRGKVVR    281 - 350
RVSLTQRTDLYRKQHAQEAIVWQQPPPTSPEPPEDNDDRQTGAELRPPPPEEDNPEVVRPHNGRVGGSPV    351 - 420
RHLYSKRLDRSVSYQLSPLDSTTPHTLVHDKAHHTLADLKRQRAAAKLQRPPPEGPESPETAEPGLPGDT    421 - 490
VTPQPDCGFRAGGDPPLLKLTAPAVEAPVERRPCCLLM                                    491 - 528
//

Text Mined References (18)

PMID Year Title
26401656 2015 Integration of Genome-Wide SNP Data and Gene-Expression Profiles Reveals Six Novel Loci and Regulatory Mechanisms for Amino Acids and Acylcarnitines in Whole Blood.
25416956 2014 A proteome-scale map of the human interactome network.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21712390 2011 Ornithine decarboxylase antizyme Oaz3 modulates protein phosphatase activity.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
19060904 2009 An empirical framework for binary interactome mapping.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16920702 2006 Phosphorylation of myosin phosphatase targeting subunit 3 (MYPT3) and regulation of protein phosphatase 1 by protein kinase A.
More...