Property Summary

NCBI Gene PubMed Count 27
Grant Count 13
R01 Count 11
Funding $973,556.21
PubMed Score 14.46
PubTator Score 11.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.847 0.000
non-small cell lung cancer -1.426 0.000
lung adenocarcinoma -1.200 0.000
ovarian cancer -1.700 0.000

Gene RIF (10)

PMID Text
24858692 this work provides the structural and molecular basis of the interaction between RBM17 and the phosphorylated form of ATXN1.
22615491 identify SPF45 as the first splicing factor regulated by multiple MAP kinase pathways and show effects of both SPF45 overexpression and phosphorylation
22190034 HIV-1 Gag is identified to have a physical interaction with RNA binding motif protein 17 (RBM17; SPF45) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21835928 dephosphorylation of pS776-ATXN1 by PP2A regulates the interaction of ATXN1 with the splicing factors RBM17 and U2AF65
18854154 Knockdown of RNA binding motif protein 17 (RBM17) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17676041 Observational study of gene-disease association. (HuGE Navigator)
17589525 The SPF45 regulates alternative splicing of the apoptosis regulatory gene CD95; 2.1-A crystal structure of SPF45-UHM in complex with a ULM peptide from SF3b155 is reported.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16061639 Resistance to various chemotherapeutics resulting from stable transfection of RBM17 (SPF45) in A2780 ovarian carcinoma cells may be due to effects of SPF45 on transcription and splicing of ERbeta-regulated genes.
14578179 overexpression of SPF45 in HeLa, a cervical carcinoma cell line, resulted in drug resistance to doxorubicin and vincristine

AA Sequence

MSLYDDLGVETSDSKTEGWSKNFKLLQSQLQVKKAALTQAKSQRTKQSTVLAPVIDLKRGGSSDDRQIVD      1 - 70
TPPHVAAGLKDPVPSGFSAGEVLIPLADEYDPMFPNDYEKVVKRQREERQRQRELERQKEIEEREKRRKD     71 - 140
RHEASGFARRPDPDSDEDEDYERERRKRSMGGAAIAPPTSLVEKDKELPRDFPYEEDSRPRSQSSKAAIP    141 - 210
PPVYEEQDRPRSPTGPSNSFLANMGGTVAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIVG    211 - 280
DATEKDASKKSDSNPLTEILKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDD    281 - 350
EAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQV                       351 - 401
//

Text Mined References (39)

PMID Year Title
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
25416956 2014 A proteome-scale map of the human interactome network.
24858692 2014 Structural basis of the phosphorylation dependent complex formation of neurodegenerative disease protein Ataxin-1 and RBM17.
24388013 2014 Genome-wide association analysis identifies 11 risk variants associated with the asthma with hay fever phenotype.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22615491 2012 Mitogen-activated protein kinase phosphorylation of splicing factor 45 (SPF45) regulates SPF45 alternative splicing site utilization, proliferation, and cell adhesion.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21835928 2011 14-3-3 Binding to ataxin-1(ATXN1) regulates its dephosphorylation at Ser-776 and transport to the nucleus.
More...