Property Summary

NCBI Gene PubMed Count 27
PubMed Score 15.46
PubTator Score 11.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Spinocerebellar Ataxias 34 0.0 0.0
Disease Target Count
Ataxia, Spinocerebellar 16
Disease Target Count P-value
non-small cell lung cancer 2890 8.0e-19
lung adenocarcinoma 2716 3.5e-14
ovarian cancer 8520 2.0e-04
osteosarcoma 7950 2.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 109 0.0 3.0
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 1 16 4.509 2.3

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.200 3.5e-14
non-small cell lung cancer -1.426 8.0e-19
osteosarcoma -1.847 2.9e-04
ovarian cancer -1.700 2.0e-04

Gene RIF (10)

AA Sequence

MSLYDDLGVETSDSKTEGWSKNFKLLQSQLQVKKAALTQAKSQRTKQSTVLAPVIDLKRGGSSDDRQIVD      1 - 70
TPPHVAAGLKDPVPSGFSAGEVLIPLADEYDPMFPNDYEKVVKRQREERQRQRELERQKEIEEREKRRKD     71 - 140
RHEASGFARRPDPDSDEDEDYERERRKRSMGGAAIAPPTSLVEKDKELPRDFPYEEDSRPRSQSSKAAIP    141 - 210
PPVYEEQDRPRSPTGPSNSFLANMGGTVAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIVG    211 - 280
DATEKDASKKSDSNPLTEILKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDD    281 - 350
EAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQV                       351 - 401
//

Text Mined References (40)

PMID Year Title