Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.57
PubTator Score 6.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7950 5.5e-05
psoriasis 6694 1.4e-04
tuberculosis and treatment for 6 months 409 1.5e-04
oligodendroglioma 2850 1.1e-02
ependymoma 4679 1.6e-02
astrocytic glioma 2597 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0
Osteoporosis 363 0.0 3.0
Disease Target Count Z-score Confidence
Retinitis pigmentosa 11 59 3.568 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.400 1.6e-02
ependymoma 1.700 1.6e-02
oligodendroglioma 1.500 1.1e-02
osteosarcoma -1.526 5.5e-05
psoriasis -1.600 1.4e-04
tuberculosis and treatment for 6 months 1.400 1.5e-04

Gene RIF (3)

AA Sequence

MAELVQGQSAPVGMKAEGFVDALHRVRQIAAKIDSIPHLNNSTPLVDPSVYGYGVQKRPLDDGVGNQLGA      1 - 70
LVHQRTVITEEFKVPDKMVGFIIGRGGEQISRIQAESGCKIQIASESSGIPERPCVLTGTPESIEQAKRL     71 - 140
LGQIVDRCRNGPGFHNDIDSNSTIQEILIPASKVGLVIGRGGETIKQLQERTGVKMVMIQDGPLPTGADK    141 - 210
PLRITGDAFKVQQAREMVLEIIREKDQADFRGVRGDFNSRMGGGSIEVSVPRFAVGIVIGRNGEMIKKIQ    211 - 280
NDAGVRIQFKPDDGISPERAAQVMGPPDRCQHAAHIISELILTAQERDGFGGLAAARGRGRGRGDWSVGA    281 - 350
PGGVQEITYTVPADKCGLVIGKGGENIKSINQQSGAHVELQRNPPPNSDPNLRRFTIRGVPQQIEVARQL    351 - 420
IDEKVGGTNLGAPGAFGQSPFSQPPAPPHQNTFPPRSSGCFPNMAAKVNGNPHSTPVSGPPAFLTQGWGS    421 - 490
TYQAWQQPTQQVPSQQSQPQSSQPNYSKAWEDYYKKQSHAASAAPQASSPPDYTMAWAEYYRQQVAFYGQ    491 - 560
TLGQAQAHSQEQ                                                              561 - 572
//

Text Mined References (33)

PMID Year Title