Property Summary

NCBI Gene PubMed Count 5
PubMed Score 769.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 9.81131783556617E-4
non primary Sjogren syndrome sicca 840 0.0139743400941502
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0270446744694898
Breast cancer 3099 0.0298995673870555
Disease Target Count Z-score Confidence
Lice infestation 16 4.715 2.4
Beriberi 13 4.46 2.2
Sarcocystosis 3 4.017 2.0

Synonym

Accession Q96I23 B2R571
Symbols PREY

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Xenopus EggNOG Inparanoid

AA Sequence

MLSGARCRLASALRGTRAPPSAVARRCLHASGSRPLADRGKKTEEPPRDFDPALLEFLVCPLSKKPLRYE      1 - 70
ASTNELINEELGIAYPIIDGIPNMIPQAARMTRQSKKQEEVEQR                               71 - 114
//

Text Mined References (6)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
16162815 2005 The initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-Y, a seventh component.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
9847074 1998 Toward a complete human genome sequence.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.