Property Summary

NCBI Gene PubMed Count 5
Grant Count 2
Funding $19,052
PubMed Score 769.97

Knowledge Summary

Patent

No data available

Synonym

Accession Q96I23 B2R571
Symbols PREY

Gene

 Grant Application (2)

AA Sequence

MLSGARCRLASALRGTRAPPSAVARRCLHASGSRPLADRGKKTEEPPRDFDPALLEFLVCPLSKKPLRYE      1 - 70
ASTNELINEELGIAYPIIDGIPNMIPQAARMTRQSKKQEEVEQR                               71 - 114
//

Text Mined References (6)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
16162815 2005 The initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-Y, a seventh component.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
9847074 1998 Toward a complete human genome sequence.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.