Property Summary

NCBI Gene PubMed Count 5
PubMed Score 960.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 2.400 3.0e-02
non primary Sjogren syndrome sicca 1.200 1.4e-02
ovarian cancer -1.700 9.8e-04
pancreatic ductal adenocarcinoma liver m... -1.131 2.7e-02

AA Sequence

MLSGARCRLASALRGTRAPPSAVARRCLHASGSRPLADRGKKTEEPPRDFDPALLEFLVCPLSKKPLRYE      1 - 70
ASTNELINEELGIAYPIIDGIPNMIPQAARMTRQSKKQEEVEQR                               71 - 114
//

Text Mined References (6)

PMID Year Title