Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma 5572 9.65507242499116E-9
posterior fossa group A ependymoma 1511 4.58342810140278E-8
pilocytic astrocytoma 3086 1.59294856009163E-7
atypical teratoid / rhabdoid tumor 4369 9.09357642203743E-7
sonic hedgehog group medulloblastoma 1482 3.69219340408154E-6
adult high grade glioma 2148 1.63200916770586E-4
primitive neuroectodermal tumor 3031 2.04169524855431E-4
medulloblastoma, large-cell 6234 0.00108304950019988

Expression

Synonym

Accession Q96I13 Q9HAE9
Symbols

Gene

PANTHER Protein Class (3)

  Ortholog (9)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Xenopus OMA Inparanoid

AA Sequence

MLTGVTDGIFCCLLGTPPNAVGPLESVESSDGYTFVEVKPGRVLRVKHAGPAPAAAPPPPSSASSDAAQG      1 - 70
DLSGLVRCQRRITVYRNGRLLVENLGRAPRADLLHGQNGSGEPPAALEVELADPAGSDGRLAPGSAGSGS     71 - 140
GSGSGGRRRRARRPKRTIHIDCEKRITSCKGAQADVVLFFIHGVGGSLAIWKEQLDFFVRLGYEVVAPDL    141 - 210
AGHGASSAPQVAAAYTFYALAEDMRAIFKRYAKKRNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGP    211 - 280
TALEPSFCSIFNMPTCVLHCLSPCLAWSFLKAGFARQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEG    281 - 350
DEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIDEGSHMVMLECPETVNTLLHEFLLWEP    351 - 420
EPSPKALPEPLPAPPEDKK                                                       421 - 439
//

Text Mined References (7)

PMID Year Title
20852631 2010 A locus on 19p13 modifies risk of breast cancer in BRCA1 mutation carriers and is associated with hormone receptor-negative breast cancer in the general population.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.