Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.300 1.6e-04
Astrocytoma, Pilocytic -1.300 3.6e-07
atypical teratoid / rhabdoid tumor -1.100 9.1e-07
glioblastoma -1.300 9.7e-09
medulloblastoma -1.200 4.7e-07
medulloblastoma, large-cell -1.500 1.1e-03
posterior fossa group A ependymoma -1.100 4.6e-08
primitive neuroectodermal tumor -1.200 2.0e-04

Synonym

Accession Q96I13 Q9HAE9
Symbols

Gene

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Protein-protein Interaction (2)

AA Sequence

MLTGVTDGIFCCLLGTPPNAVGPLESVESSDGYTFVEVKPGRVLRVKHAGPAPAAAPPPPSSASSDAAQG      1 - 70
DLSGLVRCQRRITVYRNGRLLVENLGRAPRADLLHGQNGSGEPPAALEVELADPAGSDGRLAPGSAGSGS     71 - 140
GSGSGGRRRRARRPKRTIHIDCEKRITSCKGAQADVVLFFIHGVGGSLAIWKEQLDFFVRLGYEVVAPDL    141 - 210
AGHGASSAPQVAAAYTFYALAEDMRAIFKRYAKKRNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGP    211 - 280
TALEPSFCSIFNMPTCVLHCLSPCLAWSFLKAGFARQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEG    281 - 350
DEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIDEGSHMVMLECPETVNTLLHEFLLWEP    351 - 420
EPSPKALPEPLPAPPEDKK                                                       421 - 439
//

Text Mined References (7)

PMID Year Title