Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96HZ7
Symbols PRED84
C21orf119

Gene

 Compartment GO Term (0)

AA Sequence

MGRADTPRHPPPPAAGFGVHRGAFLIPVALRVLLAGRTPRPFTPGLADPRRLGPRRVQAAQ               1 - 61
//

Text Mined References (4)

PMID Year Title