Property Summary

NCBI Gene PubMed Count 25
Grant Count 19
R01 Count 15
Funding $1,252,922.39
PubMed Score 54.54
PubTator Score 34.90

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

PMID Text
25864518 prostate cancer-specific up-regulation of NOTCH3 and HES6, is reported.
25006183 HES6 mutations are associated with castration resistant and androgen independent tumors in prostate cancer.
24737870 HES6 is up-regulated in aggressive human prostate cancer and drives tumour growth by enhancing the transcriptional activity of the AR, which is preferentially directed to a regulatory network enriched for transcription factors such as E2F1.
22982728 HES6 contributes to the pathogenesis of alveolar rhabdomyosarcoma by enhancing both proliferation and cell motility.
21785461 HES6 gene is selectively overexpressed in glioma and represents an important transcriptional regulator of glioma proliferation.
19891787 Data suggest that Hes-6 is a potential oncogene overexpressed in breast cancer, with a tumor-promoting and proliferative function. Hes-6 is a novel estrogen-regulated gene in breast cancer cells.
19481584 These four variants were tested for association with mood disorder diagnosis or antidepressant response in a family study of depression, but no significant associations were observed.
19481584 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
18160400 the Hes6-CBP complex in PML-NB may influence the proliferation of cells via p53-dependent and -independent pathways.
More...

AA Sequence

MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAKLENAEVLELT      1 - 70
VRRVQGVLRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVAAELLNHLLESMPLREGSS     71 - 140
FQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDDLCSDLEEAPEAELSQAPAEGPDLVPAALGS    141 - 210
LTTAQIARSVWRPW                                                            211 - 224
//

Text Mined References (25)

PMID Year Title
25864518 2015 HES6 promotes prostate cancer aggressiveness independently of Notch signalling.
25248455 2015 Exploring the genetics of irritable bowel syndrome: a GWA study in the general population and replication in multinational case-control cohorts.
25006183 2014 DOT1L-HES6 fusion drives androgen independent growth in prostate cancer.
24737870 2014 HES6 drives a critical AR transcriptional programme to induce castration-resistant prostate cancer through activation of an E2F1-mediated cell cycle network.
22982728 2013 HES6 enhances the motility of alveolar rhabdomyosarcoma cells.
21785461 2012 HES6 gene is selectively overexpressed in glioma and represents an important transcriptional regulator of glioma proliferation.
19891787 2009 Hes-6, an inhibitor of Hes-1, is regulated by 17beta-estradiol and promotes breast cancer cell proliferation.
19481584 2009 Expression and association analyses of promoter variants of the neurogenic gene HES6, a candidate gene for mood disorder susceptibility and antidepressant response.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18160400 2008 Hes6 controls cell proliferation via interaction with cAMP-response element-binding protein-binding protein in the promyelocytic leukemia nuclear body.
More...