Property Summary

NCBI Gene PubMed Count 25
PubMed Score 55.26
PubTator Score 34.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease 1.016 4.2e-02
astrocytic glioma 2.200 1.5e-02
Breast cancer 1.500 4.3e-09
ependymoma 1.700 4.9e-06
glioblastoma multiforme 1.100 2.3e-08
group 3 medulloblastoma 2.400 3.6e-05
intraductal papillary-mucinous carcinoma... 1.900 1.4e-02
invasive ductal carcinoma 1.300 2.7e-02
medulloblastoma, large-cell 2.200 1.3e-04
oligodendroglioma 2.900 2.2e-03
pituitary cancer -1.500 1.8e-03
primitive neuroectodermal tumor 1.700 2.7e-03

Gene RIF (16)

AA Sequence

MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAKLENAEVLELT      1 - 70
VRRVQGVLRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVAAELLNHLLESMPLREGSS     71 - 140
FQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDDLCSDLEEAPEAELSQAPAEGPDLVPAALGS    141 - 210
LTTAQIARSVWRPW                                                            211 - 224
//

Text Mined References (25)

PMID Year Title