Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.07
PubTator Score 6.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.242 0.002
astrocytic glioma -1.200 0.026
psoriasis 1.600 0.000

Synonym

Accession Q96HY6 A6NIU5 C9JSZ5 Q9BW47
Symbols UFBP1
C20orf116
dJ1187M17.3

Gene

Gene RIF (2)

PMID Text
23675531 DDRGK1 regulates NF-kappaB activity by modulating IkappaBalpha stability.
20228063 found that C53/LZAP and DDRGK1 became more susceptible to the proteasome-mediated degradation in RCAD knockdown cells, whereas their ubiquitination was significantly attenuated by RCAD overexpression

AA Sequence

MVAPVWYLVAAALLVGFILFLTRSRGRAASAGQEPLHNEELAGAGRVAQPGPLEPEEPRAGGRPRRRRDL      1 - 70
GSRLQAQRRAQRVAWAEADENEEEAVILAQEEEGVEKPAETHLSGKIGAKKLRKLEEKQARKAQREAEEA     71 - 140
EREERKRLESQREAEWKKEEERLRLEEEQKEEEERKAREEQAQREHEEYLKLKEAFVVEEEGVGETMTEE    141 - 210
QSQSFLTEFINYIKQSKVVLLEDLASQVGLRTQDTINRIQDLLAEGTITGVIDDRGKFIYITPEELAAVA    211 - 280
NFIRQRGRVSIAELAQASNSLIAWGRESPAQAPA                                        281 - 314
//

Text Mined References (20)

PMID Year Title
26544067 2015 UFBP1, a Key Component of the Ufm1 Conjugation System, Is Essential for Ufmylation-Mediated Regulation of Erythroid Development.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25219498 2014 Modification of ASC1 by UFM1 is crucial for ER? transactivation and breast cancer development.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23675531 2013 DDRGK1 regulates NF-?B activity by modulating I?B? stability.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21659334 2011 Genome-wide association study identified ITPA/DDRGK1 variants reflecting thrombocytopenia in pegylated interferon and ribavirin therapy for chronic hepatitis C.
21494687 2011 Ubiquitin fold modifier 1 (UFM1) and its target UFBP1 protect pancreatic beta cells from ER stress-induced apoptosis.
21269460 2011 Initial characterization of the human central proteome.
More...