Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.86
PubTator Score 6.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 8.9e-05
Multiple myeloma 1332 2.2e-03
astrocytic glioma 2597 2.6e-02
Disease Target Count Z-score Confidence
Hepatitis C 94 0.0 3.0
Disease Target Count Z-score Confidence
Spondyloepimetaphyseal dysplasia 12 3.294 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.200 2.6e-02
Multiple myeloma 1.242 2.2e-03
psoriasis 1.600 8.9e-05

Protein-protein Interaction (9)

Gene RIF (3)

AA Sequence

MVAPVWYLVAAALLVGFILFLTRSRGRAASAGQEPLHNEELAGAGRVAQPGPLEPEEPRAGGRPRRRRDL      1 - 70
GSRLQAQRRAQRVAWAEADENEEEAVILAQEEEGVEKPAETHLSGKIGAKKLRKLEEKQARKAQREAEEA     71 - 140
EREERKRLESQREAEWKKEEERLRLEEEQKEEEERKAREEQAQREHEEYLKLKEAFVVEEEGVGETMTEE    141 - 210
QSQSFLTEFINYIKQSKVVLLEDLASQVGLRTQDTINRIQDLLAEGTITGVIDDRGKFIYITPEELAAVA    211 - 280
NFIRQRGRVSIAELAQASNSLIAWGRESPAQAPA                                        281 - 314
//

Text Mined References (21)

PMID Year Title